KEGG   Solanum lycopersicum (tomato): 101264721Help
Entry
101264721         CDS       T02665                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sly00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101264721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sly03041]
    101264721
Enzymes [BR:sly01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101264721
Spliceosome [BR:sly03041]
 Complex C
  Other components
   Step II factors
    101264721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD ABC_tran AAA_22 AAA_30 AAA_19 DUF2075 T2SSE ATPase_2 AAA_14 AAA_29 Helicase_RecD FtsK_SpoIIIE AAA_16
Motif
Other DBs
NCBI-GeneID: 101264721
NCBI-ProteinID: XP_004239197
Position
5
AA seq 700 aa AA seqDB search
MGDLPIVRFEEKIVETVKENPVVVVIGETGSGKSTQLPQILYRRGYAKSGIIAVTQPRRV
AAVSVSRRVAQEQNVRIGEEVGYAIRFEDRTSEKTRIKYLTDGVLLRESLFNPELNQYSV
IILDEAHERSLNTDILLGLMKRLIKWRHSNLKVLITSATLDGGKVSRFFSDCPVLTVPGE
LFPVEIVHISEPPKSYVEASLKKAIDIHVREPEGDILIFMTGQDDIEKLVLKLEERVQSL
EEGSCMDALILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLEVVQISKVQAKQRAGRAGRTRPGKCYRLYPSTVYHDDFLDATVPE
IQRSSLAGTVLYLKSLDLADMDILKFDFLDSPSVKSLEDALKQLYLVDALDENGSITSLG
RKMAELPLEPSLSRTLLEANELDCLSQALTVVSMLSAETTLLPAPSKSSEKKRRHTPSNL
PDGFGLGDHIQLLQIYEQWYQTDYNIDWCKENNLQVRGMLFVRDVRKQLSQIMQKITEGS
LDVQTSNRRRGGQQEYKNLRKALCIGYANQLAERMIRHNGYRPLGFKSELVQVHPSSVLK
SDEDGMLPNYVVYHELIVTSRPFMRNVCAVEMRWVAPILAKLEKLNVFKLSGGSSQPDNQ
IQEVALTVEKKEIAAVQPPEDRASMIQAARERFLARKGQK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgggggatttacctatagtacgatttgaggagaaaatcgtagaaacagtgaaggaaaac
ccagtagtagttgttattggtgagactggttctggtaaaagtacacaacttccacaaata
ctttaccgaaggggctatgctaaatctggaatcatcgctgttactcagcctcgccgtgtt
gctgctgtttctgtttctagacgagttgcacaggagcaaaatgttcgaattggagaggaa
gtcggttatgccataagatttgaagatagaacttcggaaaaaacccgtatcaagtatctt
acggatggagtgctccttcgcgagagtctttttaatccggagctgaatcagtattcggtc
atcatattggatgaagctcatgagaggagtttgaacacggatatattgctaggtctaatg
aaaagattaatcaaatggcgtcactcaaacttgaaagtcttgatcacatcagcaactctt
gatggtggaaaggtatctaggttcttctctgactgccccgtccttactgtgccaggagag
ttatttcccgtggaaatagtacacatctcagagcctcctaaaagctatgtcgaagcttct
ttaaaaaaagctattgatattcacgtacgggagccagaaggagacattttaatatttatg
acagggcaggatgacatagagaagttggtactgaagttggaggagagagttcaaagttta
gaagaaggttcttgtatggatgccctaatccttcctcttcatggatccttaccacctgag
atgcaggtgcgtgttttcagtcctccgcctccaaattgtaggcggtttattgtttctaca
aatattgctgaaacttccttgactgttgacggtgttgtgtatgttattgactctgggtat
gtgaagcagcgacagtataacccatccactggcatgtactcgttagaggttgttcagatt
agcaaggtgcaggcaaagcagcgtgcaggacgtgctggaagaacacgtcctggaaaatgt
tatcgtttatatccctctaccgtttaccatgatgactttttggatgcaacggttcctgaa
atacaaaggtcttcactggctggaactgtactttatttgaagtccttagatcttgccgat
atggatattctcaaatttgattttctcgactctccttccgtcaagtctttggaggatgcc
ttgaagcaattatatttagtcgatgcacttgatgaaaatggttcaatcacaagtcttgga
cgaaaaatggctgagcttccactggaaccttctctttcgaggaccttattagaggcaaat
gagttggattgcttgtcccaagcattgactgttgtttccatgttgtctgctgagaccaca
ttgcttcccgccccaagtaagagctctgagaagaagaggaggcacactccttcgaacctt
cctgatggttttggcttgggtgatcacatccagctactccaaatttatgagcaatggtac
cagaccgactacaacatagactggtgtaaagaaaacaacttacaggtccgcgggatgttg
tttgtgagagatgtcaggaaacagttatctcaaataatgcaaaaaatcactgaaggctca
ttagatgtccaaacaagcaatagacggagaggtggccaacaggagtacaaaaatttgagg
aaagcactgtgcattggctacgcaaatcagcttgctgaacgaatgattcgacataacggg
tatcggcctcttggtttcaagtctgaactcgtacaggtccatccatcttctgtgctaaaa
tcagatgaggatgggatgcttccaaactatgtcgtctatcatgaattaatagttacatca
cgcccatttatgcgtaatgtatgtgcagttgagatgcgatgggttgcaccaatcttagcg
aagcttgagaaactaaatgtgttcaaactgagtgggggatctagccagcctgataaccaa
attcaagaagtagctttgactgtggaaaagaaagaaattgctgcagttcagccacccgaa
gaccgtgccagcatgatacaagctgctcgggaacgatttctagctcggaaaggtcagaag
tag

DBGET integrated database retrieval system