KEGG   Solanum lycopersicum (tomato): 101266369Help
Entry
101266369         CDS       T02665                                 

Definition
(RefSeq) probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1
  KO
K16054  methylthioribulose 1-phosphate dehydratase / enolase-phosphatase E1 [EC:4.2.1.109 3.1.3.77]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00270  Cysteine and methionine metabolism
sly01100  Metabolic pathways
Module
sly_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    101266369
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.77  acireductone synthase
     101266369
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     101266369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-GeneID: 101266369
NCBI-ProteinID: XP_004248260
Position
10
AA seq 364 aa AA seqDB search
MAIASAAPLLAMNGALKMATNSQQYVEGTIKVQNNSIPKPEQLIVISSFRGAEGKDGGRE
YVQLNHRYHNATVKLNQFGLDWTTTTHGPIHNCNGALSSTRNVKMSAKAGALASNGDIEP
LRRCIVLDIEGTTTPISFVTDVLFPYARDNVGRHLDATYDSAETQEDIKLLRAQVQEDLE
NGVAGAVPIPSNDAGKERVIAALVTNVEAMIKADRKITALKELQGHIWQTGFKNNELEGV
VFDDVPEALERWAASGIKVYIYSSGSRLAQRLLFGYTNYGDLRKYLCGFFDTTVGNKKET
KSYHEITASLGVDHPSEILFVTDVYQEAIAAKLAGLEVIISVRPGNGPLPDNHGFRTVKS
FSEI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctatagcttcagcagcaccattattggccatgaacggagctctgaaaatggcgaca
aattcacaacaatacgtggaaggtaccattaaagtccagaataactcaattcctaaacct
gaacaacttatcgtcatctcctccttcaggggtgcagaaggaaaggatggtggaagagaa
tatgtacaattgaatcatcgctatcataatgccacagttaaacttaatcagttcggactg
gactggacaacaacaactcatggtcctattcataactgcaatggtgctttaagcagcact
cgaaatgtcaagatgtctgcaaaagcaggtgctcttgcttcaaatggtgacattgagcca
ttaaggcgctgcatcgttttggatattgaaggaaccacaacgcccatatcatttgttaca
gacgttctttttccttatgctcgtgataatgtggggaggcatttggatgcaacatatgat
tctgcagaaactcaggaggatattaagctactaagagcccaagtacaagaagacttggaa
aatggtgttgccggtgctgtgcctatcccctctaatgatgctgggaaggagagggtaatt
gcggctttggtaacaaatgtggaggctatgattaaagctgaccgaaaaattactgcctta
aaagagttacaggggcatatatggcaaacggggtttaaaaataacgagttagagggagtt
gtatttgatgatgtgcccgaagctcttgagagatgggctgcttcaggcatcaaggtgtac
atatactcaagtggcagcagattggcacaaagacttttgtttggctacacaaactatggg
gacctgagaaaatacctctgcggattctttgatacaacagtagggaataagaaagaaaca
aaaagttaccatgaaattacagcatccttgggggtagatcacccatccgagattttgttc
gtgactgatgtctatcaagaagctatagctgcaaaactagcaggtttggaagtgataata
tctgtcaggccagggaatggacctcttccagataatcatggatttaggacggtcaagtcc
ttttcagaaatctaa

DBGET integrated database retrieval system