KEGG   Solanum lycopersicum (tomato): 101268695Help
Entry
101268695         CDS       T02665                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00052  Galactose metabolism
sly00500  Starch and sucrose metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101268695
   00500 Starch and sucrose metabolism
    101268695
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101268695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 101268695
NCBI-ProteinID: XP_004241885
Position
6
AA seq 531 aa AA seqDB search
MAQPYRTAYHFQPPKNWINDPNGPMIYKGIYHLFYQYNPESAEWGNIAWGHSTSTDLVNW
TIHPPALLPSDAYDINGCWSGSATILQDGTPAILYTGGNSQKVQLQNLAVPKDPSDPYLV
EWVKSPDNPIMIPNEDEKESFRDPTTAWLGPDGIWRVVIGNERENRGTAVLYKSEDFIRW
TEAERPLHSSSETTMWECPDFFPVLVDGENGLDISEIFSGIKHVLKNSVARSFVDYYTVG
AYDHHNDVYTPDEGSVDNESGLRLDYGRYYASKSFFDSEKKRRIFIAWVNESTSKEIDLI
KGWSGLQSFPRKIWLDKGGKQLVQWPVEEIEMLRTNKVDLQNITLEAGLKREICGVTAAQ
ADVEISFSIPIAVLEQAEVLESNWTNPQEIANQSGSLANTGVGPFGLLVLASNKIEEYTA
IFFRIFKKNDKFVVLMGCDQKRSSVGLEYDKTNYGAFLDIDPLTEKLSLRTLIDHSIVES
FGGGGKACITTRAYPTLAINDNAHIFVFNNGSQHVDISTLSAWSLNQAHIN
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctcagccttacagaactgcttatcatttccaacctcccaagaattggataaatgat
cctaatggaccaatgatctacaagggaatttaccatttattttaccagtacaatcctgaa
agtgcagaatggggaaacatagcatggggccattctacttcaactgatcttgtcaactgg
actattcatcctcccgctcttttgccttcagacgcatatgatatcaacggttgttggtca
ggttctgcgacgatcctccaagatggcacaccagctatactctataccggaggcaattca
caaaaagttcaacttcaaaatctagctgtgcctaaagatccatccgacccttaccttgtc
gaatgggttaaatctcctgataatccaatcatgataccgaatgaagatgagaaagaatcg
tttagagacccaaccaccgcgtggttagggcctgatgggatttggagagttgttatagga
aatgaaagagaaaacagaggaactgctgttttatataagagtgaagattttattcgttgg
actgaagcagagcggcctctgcattcgtccagtgaaactacaatgtgggaatgccctgat
tttttccctgtcttagttgacggggaaaatggacttgacatttcagagattttttcaggg
ataaaacacgtgcttaaaaatagcgtggctcgttcatttgttgattattatactgttgga
gcgtatgaccatcacaacgatgtgtatacaccagatgagggatcggtagacaatgaatca
ggattacgattggattatggaaggtattacgcttccaaatctttttttgatagtgagaag
aagaggagaatcttcattgcttgggttaatgagtctacaagtaaggaaatcgatttaatt
aaaggatggtctggtcttcagtcgtttcctaggaaaatttggctggataaaggtggaaag
caattggttcaatggcctgttgaagaaatcgaaatgctgaggacaaacaaagttgattta
caaaatataacactcgaagctggtttaaaacgtgagatttgtggtgtcactgctgcacag
gctgatgtagaaatctccttctcaattccaattgcggtgcttgagcaggcagaggtgctg
gaatcaaattggacgaatccacaagagatagctaaccaaagtggttcattagccaacact
ggtgttggaccttttgggttgctagttttggcctcaaataaaattgaagaatatacagca
atattctttagaattttcaaaaagaatgacaagtttgttgtgttaatgggctgtgaccaa
aaaaggtcatctgtgggccttgaatatgataaaaccaattatggagcctttttggacatt
gatcctcttacagaaaaattatcactaagaactttgattgatcattcgattgtagaaagc
tttggcggaggtggaaaagcttgcatcacaacaagagcttatccaactttggccatcaat
gataatgcccatatttttgttttcaacaatggatcccaacatgttgacatctccactttg
agtgcttggagcctaaaccaggctcacatcaattga

DBGET integrated database retrieval system