KEGG   Solanum lycopersicum (tomato): 101268816Help
Entry
101268816         CDS       T02665                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sly01001]
    101268816
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101268816
Protein kinases [BR:sly01001]
 Serine/threonine kinases: TKL group
  IRAK family
   101268816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF1959 APH GrlR
Motif
Other DBs
NCBI-GeneID: 101268816
NCBI-ProteinID: XP_025884860
Position
2
AA seq 240 aa AA seqDB search
MEKQLFGQLEILNWNFSPRLQHRVNDTWEYGSTKYQYRQWYGSSKLLYVNKSKNDDLDLL
LFDFATILAANNNFSLRNKIAEGDFGHVYKVALKDGQEKAVKRLSRYSAQGTDEFKNEVI
FIAKLHQRNLVKLLGCCIQAEEKMLVYEYMPNNSSYWFLFDTDRRSLLDGPKCFHIINGI
ARGLLYIHQDSRLRIIHRDLKPINYLLDINMNPKISDFGMARSFGGNEIGAMTTRVVGTL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaattgtttggtcagctggaaattttgaattggaatttttctccccgactt
caacatcgagtaaacgatacatgggaatatggttcaacaaagtatcaatatagacagtgg
tatggaagctctaaattgttgtatgttaataaaagcaaaaatgatgatctagatttacta
ttatttgattttgccactatcttggccgctaacaataatttttctttgagaaacaagatt
gcagagggtgattttggacatgtttacaaggttgcgctgaaagatgggcaagaaaaagca
gtaaagagactatcaagatactcagcacagggaactgatgagttcaagaatgaggttatc
tttattgctaaactccaccaacggaatctagtgaaactactaggttgttgtatccaagct
gaagaaaaaatgttggtttatgagtacatgcctaataatagctcttattggttccttttt
gatacagataggaggtcattgcttgatgggcctaagtgcttccatattattaatggaatt
gctcgtggacttctctatattcatcaagactcaagattgcggataatccacagagatctt
aaacctataaattatttgctagacattaatatgaacccgaagatatctgactttggcatg
gcaagaagttttggaggaaatgagattggagccatgacaacaagagtggttggaacattg
taa

DBGET integrated database retrieval system