KEGG   Solanum lycopersicum (tomato): 543773Help
Entry
543773            CDS       T02665                                 

Gene name
ide
Definition
(RefSeq) insulin degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sly01002]
    543773 (ide)
Enzymes [BR:sly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     543773 (ide)
Peptidases and inhibitors [BR:sly01002]
 Metallo peptidases
  Family M16: pitrilysin family
   543773 (ide)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 543773
NCBI-ProteinID: NP_001233926
UniProt: A0A3Q7GSC1 Q93YG9
Position
4
AA seq 971 aa AA seqDB search
MAVGKKEENMAVEIVKPRIDKRDYRRIVLQNNLEILLISDPETDKCAASMNVCVGAFSDP
EGLEGLAHFLEHMLFYASEKYPVEDSYSKYITENGGSTNAFTSSEDTNYYFEVNADGFEE
ALDRFAQFFIKPLMSADATTREIKAVDSEHQKNLLSDPWRMNQLQKHLSAENHPYHKFST
GSWDTLEVRPKERGIDTRQELLKFYSENYSANLMHLVVYSKDSLDKVEQLVRGKFQDIRN
IDRNQIHFTGQPCIMEHLQILVRAVPIKQGHKLKIIWPITPGIHHYKEGPCRYLGHLIGH
EGEGSLFYVLKKLGWATSLSAGESDWTNEFSFFKVAIDLTDAGQDHFEDIMGLLFKYIHL
LQQAGASKWIFEELSAICETAFHYQDKIRPSDYVVNVAMNMQHYPPEDWLVASSLPSKFN
PSIIQSFLNELNPDNVRIFWESTKFEGNTSMTEPWYGTAYSIEKVGGDSIKQWMEHAPSE
ELHLPAPNVFIPTDLSLKPVFEKTKVPILLRKSPYSRLWYKPDTAFSSPKAYVMIDFSCP
YCGHSPEAEVLTEIFTRLLMDYLNEYAYNAQVAGLYYDISKTNSGFQLTLFGYNDKLRVL
LEAVIEKVAKFEVKPDRFSVVKELVTKQYQNFKFQQPYQQVMYYCSLLLKDNIWPWNEEL
EVLPHLKVDDLVKFYPLLMARSFMECYVAGNVEQAEAESMIQLIEDVFFKGPQSISKPLF
ASQHLTNRVVNLERGVNYVYAAEGLNPSDENSALVHYIQVHQDDFMLNVKLQLFALIAKQ
PAFHQLRSVEQLGYITVLMQRSDSGVHGVQFIVQSTAKDPKYIDTRVELFMKMFESKLYE
MTSDEFKNNVNALIDMKLEKHKNLREESRFYWREISDGTLKFDRRDREIVALKQLTQKEL
TDFFDEYIKVGVPRKKALSVRVYGSSHSSQFQAHKNEQMEPNAVQIEEIFSFRRSRPLYS
SFKGGFGHVRL
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggcagttggtaaaaaggaagaaaatatggcagtagagatagtgaagcctcgaattgat
aaaagggattacagaagaattgttcttcaaaataatcttgaaattcttctgatcagtgac
ccagaaactgataaatgtgcagcttcaatgaatgtgtgtgttggtgcttttagtgatcct
gagggacttgaaggccttgcccattttcttgaacatatgctgttttatgcaagtgagaag
tatcctgtggaggatagttattcaaagtacataacagagaatggaggtagtacaaatgct
tttacatcttctgaggacaccaactactattttgaagtaaatgctgacggtttcgaagaa
gcattggacagatttgcccagttctttatcaaaccattgatgtcagcagatgctacaact
cgagaaattaaagctgttgattctgaacaccagaagaatctactctctgatccttggaga
atgaaccagcttcaaaaacatttaagcgcggaaaatcatccataccataaattcagcaca
ggcagctgggatacattagaggtcagaccaaaagaaagaggcatagatacaagacaggag
cttctcaaattttattcagaaaattattcagccaatctcatgcacttggtcgtctattcg
aaagatagtcttgataaagttgagcagttggtgcggggtaaattccaggacatccggaac
atagatcgtaatcaaatccattttactggtcagccttgcatcatggaacatctccagatt
cttgttcgagctgttccaataaaacaaggtcacaagctgaaaatcatatggcctataacc
ccaggcatacatcactacaaggaagggccttgtaggtacctgggccacttgattggccat
gaaggagaaggatcattgttttatgtcttgaaaaagttgggatgggctacaagtttatct
gctggtgaatcagactggactaacgagttctctttctttaaagtggcgattgatttgact
gatgctggtcaagatcattttgaagacattatgggtctcctattcaaatatattcatctt
ctacaacaagctggtgcgtccaaatggatatttgaagagctctcagctatttgtgagact
gccttccattatcaagacaagattcgaccaagtgattatgtggttaatgttgcaatgaat
atgcagcactatcctccagaagattggttggtggcatcctcgttgccttcaaagtttaat
cctagcattattcagtcattcttgaatgaactcaacccagacaatgtcagaatcttctgg
gagtcaacaaagtttgagggtaatactagcatgactgagccatggtatggaactgcatat
tctatagagaaagttggtggtgacagtatcaagcaatggatggagcatgctcccagtgaa
gagctgcatctccctgctcccaatgtgttcataccaactgatttatcacttaagcccgtc
ttcgagaagacaaaagttcccatacttctgcggaagtcaccttattcaaggttatggtat
aagcccgatacagcattttcatctccaaaagcctatgttatgatcgatttcagttgccca
tactgtggacattctccagaagctgaggttcttactgagatatttacacgtctattgatg
gattacttgaatgaatatgcttataatgcacaagttgctggtctttattatgatataagc
aaaacaaacagtggttttcagttgacattgtttggatataatgacaagttgagagtctta
ctggaagcagtcattgaaaaagttgcgaaatttgaagtaaaaccagacagattctctgtg
gtcaaggaattggtgacaaagcaatatcagaatttcaagttccaacagccatatcaacag
gttatgtattactgctcattactgctaaaagacaacatatggccttggaatgaagaactt
gaagtgcttccacatcttaaagttgatgatctggttaagttctatccgcttttgatggct
aggtcctttatggagtgctatgtagcaggaaatgttgaacaagctgaagcagagtccatg
atacagcttattgaagatgtgttcttcaagggtccacagtcaatatcaaagcctctattt
gcatctcagcatctgacaaacagagtggtcaatcttgaaagaggtgtaaattatgtctac
gctgcagagggactaaatccaagtgatgaaaattcagctcttgttcattatattcaggtg
catcaggatgactttatgctgaatgtaaaacttcagctttttgctctcatagcaaagcag
ccagccttccaccagcttagatcagtcgagcaacttggttatatcactgtgctcatgcag
aggagcgactctggtgttcacggggtgcagtttatcgttcagtcaactgcaaaggatccc
aaatacattgacacaagagtggagttatttatgaagatgtttgagagcaagctttatgag
atgactagtgatgaattcaagaataatgtcaatgcacttattgatatgaagcttgagaaa
cacaagaatttacgggaggaatctcggttttactggagggagatctcagatgggaccctc
aagtttgatagacgagaccgtgagattgtcgcgttaaagcaactgactcaaaaggagctg
acagatttcttcgatgaatatattaaagtcggtgttcctcggaagaaggccttaagtgtc
agagtctatggaagctcacattcttctcaattccaagcacataagaatgagcagatggaa
ccaaatgcagttcagatagaagaaatatttagctttcgacgatctcggcctctttatagt
tcattcaaaggaggctttggtcatgtgagattgtaa

DBGET integrated database retrieval system