KEGG   Solanum lycopersicum (tomato): 543865Help
Entry
543865            CDS       T02665                                 

Gene name
PPCK2
Definition
(RefSeq) phosphoenolpyruvate carboxylase kinase 2
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sly01001]
    543865 (PPCK2)
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     543865 (PPCK2)
Protein kinases [BR:sly01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   543865 (PPCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal Kdo Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 543865
NCBI-ProteinID: NP_001234304
UniProt: Q84JP7
Position
6
AA seq 278 aa AA seqDB search
MSESLKRNYCVGGELGRGRFGTVFKCYSSATGELFAVKSIDKRLIADDAIDRQCLYNEAK
IMHLLSPNPNVVRVFDIYEDDTHLDMVLELCNSGDLFQRLSSQPIFSESDAVDVMVPLMK
AIAHCHRLGVAHRDIKPDNILFTDSNELKLADFGSAECFHEGQLMSGVVGTPYYVAPEVL
AGRNYSEKIDIWSAGVILYIMLAGVPPFFGDSASEIFEAVLRANLRFPPRIFHSVSPAAK
DLLRRMLSKDVSRRFSAEQVLRHPWMTSNGEIRTVAPF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtcactgaagcgaaattattgtgtgggtggagagttaggaaggggacgattc
ggcaccgttttcaagtgttactcgtcggcgaccggtgagctattcgccgtcaagtctatc
gacaagcgcctaatcgccgatgacgccatagatcgacaatgtctttacaacgaagcgaaa
attatgcacttgctttcgccaaatcctaatgttgttcgtgttttcgatatctacgaggac
gatactcaccttgatatggttttagagctctgcaactccggcgatttgttccaacgcctc
agtagtcaaccgattttctcagagtccgacgctgttgatgtcatggtaccactaatgaaa
gcaatagcgcactgtcaccgtctcggtgtagcccacagggacatcaaaccggataacatt
ttattcaccgactctaacgaactgaaattggctgattttggatcggcggagtgtttccat
gagggccagctgatgagcggcgtggttggaacgccgtattatgtggcgccagaggtttta
gctgggagaaactacagtgagaagatcgatatttggagtgctggtgttattctgtatata
atgcttgccggagttccacctttctttggtgactcagcttcagagatcttcgaggctgtg
ctcagagctaaccttaggtttccgcctaggatcttccattcagtatcgccggcggcgaag
gatttgcttcggagaatgctctctaaagacgtttctagaagattctctgccgaacaagtt
ctcaggcatccatggatgactagcaacggagaaatcagaacagttgctccattttag

DBGET integrated database retrieval system