KEGG   Solanum lycopersicum (tomato): 544197Help
Entry
544197            CDS       T02665                                 

Gene name
GPXle-1
Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00480  Glutathione metabolism
sly00590  Arachidonic acid metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    544197 (GPXle-1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    544197 (GPXle-1)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     544197 (GPXle-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 544197
NCBI-ProteinID: NP_001234567
Position
8
AA seq 169 aa AA seqDB search
MASQSSNPQSVYDFTVKDAKGKDVDLSIYKGKVLIIVNVASQCGLTNSNYTDMTELYKKY
KDQGLEILAFPCNQFGGQEPGNIEDIQQMVCTRFKAEYPIFDKVDVNGDNAAPLYRFLKS
SKGGFFGDGIKWNFSKFLIDKEGHVVDRYSPTTSPASMEKDIKKLLGVA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcaatcaagcaaccctcaatctgtttatgatttcactgtcaaggatgctaag
ggcaaggacgttgatctcagtatttacaagggaaaagtccttatcattgtcaatgttgca
tcacagtgtggcctgactaattcgaactacactgacatgacggagttatacaagaagtac
aaggatcaaggtttggagattctggccttcccttgcaaccagtttggtggacaggagcct
ggaaacattgaagatatccagcaaatggtctgcactcgcttcaaggctgagtaccccata
tttgacaaggttgacgtgaatggtgataatgctgctccattatataggtttctgaaatca
agcaaaggtgggttctttggagatggtatcaagtggaacttctccaaattcctcattgac
aaagaaggacatgtcgttgatcgctactctccaaccacttctccagctagcatggagaag
gatatcaagaaactcttgggtgttgcttaa

DBGET integrated database retrieval system