KEGG   Solanum lycopersicum (tomato): 778285Help
Entry
778285            CDS       T02665                                 

Gene name
mMDH1
Definition
(RefSeq) malate dehydrogenase 1
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00020  Citrate cycle (TCA cycle)
sly00270  Cysteine and methionine metabolism
sly00620  Pyruvate metabolism
sly00630  Glyoxylate and dicarboxylate metabolism
sly00710  Carbon fixation in photosynthetic organisms
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
Module
sly_M00012  Glyoxylate cycle
sly_M00168  CAM (Crassulacean acid metabolism), dark
sly_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    778285 (mMDH1)
   00620 Pyruvate metabolism
    778285 (mMDH1)
   00630 Glyoxylate and dicarboxylate metabolism
    778285 (mMDH1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    778285 (mMDH1)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    778285 (mMDH1)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     778285 (mMDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD DapB_N
Motif
Other DBs
NCBI-GeneID: 778285
NCBI-ProteinID: NP_001234001
UniProt: K4CGU8
Position
7
AA seq 346 aa AA seqDB search
MRTSMLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVS
SLSLYDIAGTPGVAADVSHINTRSEVAGFAGEEQLGQALEGADVVIIPAGVPRKPGMTRD
DLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTM
LDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGITILPLFSQATPKANLSDEEIVALTKRTQ
DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECAFVQSNVTELPFFASK
VRLGKNGVEEVLGLGPLNDYEKQGLEALKPELLSSIEKGIKFAKEN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaggacctccatgttgaaatccatcgtccgccggagctccactgccggagcatcctat
gtatctcgccgtggattcgcatcgggatccgcgccggagaggaaagttgcagttttgggg
gcagccggagggattggacagcctttatctcttctaatgaagcttaaccctttagtatcc
agcctttcactctacgatatcgccggtactcccggtgttgccgccgatgttagtcacatc
aacaccagatctgaggttgccggttttgcaggagaagagcagctagggcaggcactggaa
ggagctgatgttgttatcattcctgctggtgtgccccgaaagcctggtatgacccgagat
gatctgttcaacattaatgcgggtattgttaaatctctatgcacggccattgctaagtac
tgccccaatgctctggtcaatatgataagcaacccagtgaattccactgtccctattgct
gctgaggtgtttaagaaagctggaacttatgatgaaaagaagctctttggagttaccatg
cttgatgtggttagggccaagacattttatgctggaaaagctaaagtaaatgttgctgag
gtcaatctcccagtagttggtggtcatgctggcataactatcctcccattattttctcaa
gccactccaaaggcaaatctatcagatgaggaaattgttgcactcacaaagcgaacccaa
gatggtgggacagaagttgtagaggccaaggctggaaagggttcagccaccctctcaatg
gcctatgctggggctatttttgccgatgcttgcttgaaggggttgaatggagttcccgat
gttgttgaatgtgcttttgtgcagtccaatgtcaccgagcttcccttcttcgcatccaag
gtaagacttgggaaaaatggagtggaggaagtcctagggttgggtccacttaacgactac
gagaagcaaggacttgaggctcttaagccagagctgctctcctccattgaaaagggaatc
aagtttgccaaagaaaactaa

DBGET integrated database retrieval system