KEGG   Solanum lycopersicum (tomato): 778298Help
Entry
778298            CDS       T02665                                 

Gene name
LEMT1
Definition
(RefSeq) metallothionein-like protein type 2 B
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif
Pfam: Metallothio_2 Metallothio_PEC
Motif
Other DBs
NCBI-GeneID: 778298
NCBI-ProteinID: NP_001234046
UniProt: Q40158
Position
9
AA seq 82 aa AA seqDB search
MSCCGGNCGCGSSCKCGNGCGGCKMYPDMSYTESSTTTETLVLGVGPEKTSFGAMEMGES
PVAENGCKCGSDCKCNPCTCSK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgctgtggaggaaactgtggctgtggatctagctgcaagtgcggcaacggctgt
ggaggttgcaagatgtacccagacatgagctacaccgaaagcagcacaaccactgagact
ttggtgcttggggtgggacctgagaagacaagcttcggcgccatggagatgggtgaatcc
cctgttgctgagaatggctgcaaatgtggatctgactgcaagtgcaacccttgcacttgt
tctaagtga

DBGET integrated database retrieval system