KEGG   Solanum lycopersicum (tomato): 778299Help
Entry
778299            CDS       T02665                                 

Gene name
MT2
Definition
(RefSeq) metallothionein-like protein type 2
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif
Pfam: Metallothio_2 Metallothio_PEC
Motif
Other DBs
NCBI-GeneID: 778299
NCBI-ProteinID: NP_001234050
UniProt: Q43515
Position
6
AA seq 76 aa AA seqDB search
MSGCGGSCNCGSSCSCGKGGGCNMYPDLEKSTTLTIIEGVAPMNNKGMVEGSIEKATEGG
NGCKCGSSCKCDPCNC
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtctggctgtggaggaagctgtaattgtggttctagctgcagttgcggcaagggcgga
gggtgcaacatgtaccctgatttggagaagtcaactacccttaccatcatcgagggagtt
gcacctatgaacaacaagggaatggttgaaggatcaattgagaaagctacagaagggggg
aatgggtgcaagtgtggctcaagctgcaagtgtgacccttgcaactgttga

DBGET integrated database retrieval system