KEGG   Staphylococcus lutrae: B5P37_00185Help
Entry
B5P37_00185       CDS       T04991                                 

Definition
(GenBank) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
slz  Staphylococcus lutrae
Pathway
slz00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:slz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B5P37_00185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slz01007]
    B5P37_00185
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slz03016]
    B5P37_00185
   03029 Mitochondrial biogenesis [BR:slz03029]
    B5P37_00185
Enzymes [BR:slz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     B5P37_00185
Amino acid related enzymes [BR:slz01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   B5P37_00185
Transfer RNA biogenesis [BR:slz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    B5P37_00185
Mitochondrial biogenesis [BR:slz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B5P37_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ARJ49877
UniProt: A0A1W6BIW4
Position
32144..33538
Genome map
AA seq 464 aa AA seqDB search
MEKKNMDKIVQLAKHRGFVFPGSEIYGGLANTWDYGPLGVELKNNIKKAWWKKFITQSPY
NVGLDAAILMNPKTWEASGHLANFNDPMIDNKDSKIRYRADKLIEDYMANVKGDENFIAD
GLSFDEMKRIIDEEGITCPVSGTANWTDIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGI
FVNYKNVQRTMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGTEIEWQ
NYWKNFAAQWLENLGLNKENTRLRDHDEDELSHYSNATTDIEYRFPFGWGELWGIASRTD
FDLKQHSTHSGEDFNYHDPETNEKYLPYCIEPSLGADRVTLAFLCDAYEEEGIEGSNDAR
TVLHFHPAIAPYKAAILPLSKKLSAEAIKVYEQLSESFAVDFDESQSIGKRYRRQDEIGT
PYCITFDFDSLEDQQVTVRDRDTMEQVRMPIHELNAFLSEKVKF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaagaacatggacaaaattgtacaattggcaaagcatagaggctttgtattt
ccaggtagtgagatctatggtgggttagcaaatacttgggattatggcccactcggtgtt
gaattgaaaaacaatataaaaaaagcgtggtggaaaaaattcatcacacaatccccttat
aatgttggtttagacgcagcaattttaatgaacccgaaaacttgggaagcttcaggacac
ttggcgaactttaatgatccaatgattgataacaaagatagtaaaatccgttatcgtgcg
gacaaactcattgaagattacatggcaaatgtaaaaggcgatgaaaatttcattgctgat
gggttgagttttgatgagatgaaacggatcatcgatgaagaaggaatcacttgtcctgtt
agtggcacagcaaactggactgacattcgacaattcaatttgatgtttaaaacgtttcaa
ggcgtaactgaggactctacgaatgaaatctttctacgtcctgaaacagcacaaggtatt
tttgtgaattataaaaatgtacagcgtacgatgcgtaaaaaattaccttttggtattggt
caaatagggaaatcattccgtaatgaaatcactccgggtaattttattttccgtacacgg
gagttcgaacaaatggagttggaatttttctgtaagcctggtactgaaattgagtggcaa
aattactggaaaaactttgccgcacaatggctagaaaatttaggcttaaacaaagagaac
acgcgcttacgcgaccatgatgaagatgagctatcacattattctaatgcaacgactgac
atcgaatatcgtttcccattcggttggggcgaactatggggtattgctagtcgtacagac
tttgatttaaaacaacatagtacacattcaggtgaagactttaactatcatgatcctgaa
acaaatgaaaagtatttgccatattgtattgagccatcattaggtgcagaccgtgttact
ttggcattcctttgtgatgcatatgaagaagaaggcattgagggcagtaacgatgcacgt
acagtgctacacttccatcctgccatcgcaccatataaagctgcaatattaccgttaagt
aaaaagctgtctgcagaagcgattaaagtctatgaacaattgagcgaatcatttgctgta
gattttgatgaatcacagtctattggtaaacgttatcgtcgtcaagatgaaattggtaca
ccatactgtatcacttttgattttgattctttagaagatcaacaagtaaccgttcgtgac
cgtgatacaatggaacaagttcgtatgccaattcacgaattaaatgcatttttatcagaa
aaagtaaagttttag

DBGET integrated database retrieval system