KEGG   Staphylococcus lutrae: B5P37_02775Help
Entry
B5P37_02775       CDS       T04991                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
slz  Staphylococcus lutrae
Pathway
slz00220  Arginine biosynthesis
slz00330  Arginine and proline metabolism
slz01100  Metabolic pathways
slz01110  Biosynthesis of secondary metabolites
slz01130  Biosynthesis of antibiotics
slz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B5P37_02775
   00330 Arginine and proline metabolism
    B5P37_02775
Enzymes [BR:slz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B5P37_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ARJ50316
UniProt: A0A1W6BKI3
Position
complement(556516..557421)
Genome map
AA seq 301 aa AA seqDB search
MDKTIELIGAPTTFGQKKLGVDLGPDAIRYAGALPRLKRIGHQVIDSGNVEAPRVDIEKF
TSQQEGLQNYEEILTFSKALKDKVSESIRQNHFPVILGGDHSLAIGSISGVAEHYQQLGV
IWYDAHGDLNVPEESPSGNVHGMPLRILAGEGDSQLVQLGGFMPKVKPENIVLIGMRDLD
YGERAYIKQHQIRTYTMADIDERGIRPIIEESIAYLKDKTDGVHLSLDVDALDPNETPGT
GTKVSGGLTYRESHYALELLNASGLITSMDIVEVNPLLDRENRTAEQAVALLGSFFGETL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggataagacaatagaacttatcggtgcaccaacaacttttggacaaaagaaattaggg
gttgatttaggtccagatgcaattcgttatgcaggtgcattaccaagattaaaacgtata
gggcatcaagtcattgattcaggaaatgttgaagcacctcgagtagatattgagaaattc
acctctcaacaagagggattacaaaactatgaggaaattcttacattttctaaagcgtta
aaagataaagtatcggaaagtattcgtcaaaaccattttccagttattcttggcggagat
cattcgttagcgattggttctatttccggagtagcagaacattatcagcaattaggcgtt
atttggtatgatgcccatggtgacttaaatgtccctgaagaatcaccttctggaaatgtc
catggcatgccacttcgcattttggctggtgaaggggattcacaattagttcaactcggt
ggttttatgccgaaagtgaaacctgaaaatattgtccttatcggtatgcgagatttggat
tatggggaacgggcctatatcaaacaacatcaaattagaacgtatacaatggccgacatt
gatgaacgaggtatacgtcctataattgaagaaagtattgcgtatttgaaagataaaaca
gacggcgttcatttatcattagatgttgatgcattagatccaaatgaaacaccaggtaca
ggcactaaagtttcgggagggttaacttatcgggaaagccactacgcgttagaattgtta
aatgcttcaggattgattacgtcaatggatattgtggaagtcaatccgttattagataga
gaaaatcggactgcagagcaagcggtcgcattactcggctcattctttggagaaacgtta
ttgtaa

DBGET integrated database retrieval system