KEGG   Staphylococcus lutrae: B5P37_07315Help
Entry
B5P37_07315       CDS       T04991                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
slz  Staphylococcus lutrae
Pathway
slz00071  Fatty acid degradation
slz00280  Valine, leucine and isoleucine degradation
slz00310  Lysine degradation
slz00362  Benzoate degradation
slz00380  Tryptophan metabolism
slz00620  Pyruvate metabolism
slz00630  Glyoxylate and dicarboxylate metabolism
slz00640  Propanoate metabolism
slz00650  Butanoate metabolism
slz00900  Terpenoid backbone biosynthesis
slz01100  Metabolic pathways
slz01110  Biosynthesis of secondary metabolites
slz01120  Microbial metabolism in diverse environments
slz01130  Biosynthesis of antibiotics
slz01200  Carbon metabolism
slz01212  Fatty acid metabolism
slz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5P37_07315
   00630 Glyoxylate and dicarboxylate metabolism
    B5P37_07315
   00640 Propanoate metabolism
    B5P37_07315
   00650 Butanoate metabolism
    B5P37_07315
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5P37_07315
   00072 Synthesis and degradation of ketone bodies
    B5P37_07315
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5P37_07315
   00310 Lysine degradation
    B5P37_07315
   00380 Tryptophan metabolism
    B5P37_07315
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B5P37_07315
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5P37_07315
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B5P37_07315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slz04147]
    B5P37_07315
Enzymes [BR:slz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B5P37_07315
Exosome [BR:slz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5P37_07315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARJ51124
Position
1591825..1592967
Genome map
AA seq 380 aa AA seqDB search
MTKAIIVTAKRTPIGVYGGMLQKWEPEQLLKPLFEHFSATLPLSLDTLDDVILGNVVGKG
GNIARKSLLEAGIDVSVPGLTVDRQCGSGLEAIHLACRLVESGAGDFYIAGGVESTSRAP
WKIEKPTSLYSSTPPLFYERAPFAPAGQDPSMIEAADHVAQQYHVSREDQDGFAIRSHQR
TSQAMAQGLLSNEILPLKVKGQYIEQDESVKPHLQYDRISRLKPLRHGGSVTVGNCCLKH
DGACLVVVMSEARACQVGLTEGLLFVDYAVEGVSPHVLGIGPVPAVTRILERQQLRIDQI
DAVELNEAFSAQVLASQRELGIRDDQLNRYGGAIAIGHPYSASGAMLVTRLFYMTQAHRT
IATMGIGGGMGNAALFERWG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcaattattgtaaccgcaaaacgtacaccgattggggtttatggtggcatg
ttacaaaaatgggaacctgaacaactgctcaagccattgtttgaacatttctccgccaca
ttgcccctatctctggatacattagacgatgttatcttggggaatgttgtcggtaaagga
ggaaatattgcgagaaagagtcttttggaagcaggaatcgatgtgtctgtgccaggattg
acagtagatcgtcaatgtggttcaggattggaagcgattcatctggcgtgtcgccttgtt
gaaagtggcgcaggcgatttttatattgcaggaggcgtggaaagtacaagtcgtgcgcct
tggaaaatagaaaaaccgacatcgctttattcgtctacaccgccattattttatgagcgc
gcgccatttgcacctgcgggtcaggacccgagtatgattgaagcggcggatcatgtggca
caacagtatcacgtatcacgagaagaccaagatgggtttgcgattcgcagtcatcagcgt
acgagtcaagcgatggctcaaggcctcttgtcaaatgaaattctcccgttaaaggttaaa
ggtcagtacattgaacaagacgaaagtgtcaaaccgcatcttcagtatgaccgtatttct
cgtttgaaaccgttacgtcacggcggatcagtaacagtgggaaattgctgtcttaagcat
gacggtgcttgtttagtcgtggtcatgtcagaagcgcgtgcatgtcaagtcggattgaca
gaaggcttgttgtttgtggattacgccgttgagggggtttcgccacatgtcttaggtatc
ggtcctgtccccgcagtgacgcgcattttagagcgccaacaattgaggattgaccaaatt
gatgcggtggaactcaatgaagcatttagtgcacaagttcttgcgtcccaacgtgaatta
ggaatacgcgatgatcaactcaatcgttatggcggcgcaattgcaatcggtcatccgtac
agtgcgagcggtgcgatgttagtgacgcgtttattttatatgacgcaagcccatagaacg
attgcgacgatggggattggaggcggaatggggaatgcagcactctttgaacgttgggga
taa

DBGET integrated database retrieval system