KEGG   Streptomyces avermitilis: SAVERM_1082
Entry
SAVERM_1082       CDS       T00126                                 

Gene name
agaB1
Definition
(GenBank) putative alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
sma  Streptomyces avermitilis
Pathway
sma00052  Galactose metabolism
sma00561  Glycerolipid metabolism
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SAVERM_1082 (agaB1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_1082 (agaB1)
   00600 Sphingolipid metabolism
    SAVERM_1082 (agaB1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SAVERM_1082 (agaB1)
SSDB
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2
Other DBs
NCBI-ProteinID: BAC68792
NITE: SAV1082
UniProt: Q82P51
Position
1363816..1365948
AA seq 710 aa
MSLISFAPHSGVWLLTTPHTSYALRIDASGAPCHLAWGPRLTLAAAEELAVPEPPAASSF
EGRPSVGEELPVDGGVRYGPPSLQVRFADGSRAFEWQPTGHRVHESADGAHELVLFFRDR
RYPLQVALHYRVRADTDVIERWTVVRNGGDEPVTLLRADSAAWTLPPLADYRLSHVTGQW
SAESRLRRDRLPYGETVLTSRRGITSHHTNPWLMVDSGEATEDHGRVWSAALAWSGSWRI
TTQRTPDGRTGFTGGVGHDGTGVPLTPGEEFTAPAFAGLFTADGFGAASRAWHAYTLAHV
LPHPDEPVPVLYNSWEATGFDVDEVGQKALAERAAALGVELYVVDDGWFGGRRSDRAGLG
DWTPAPDRFPDGLGPLADRVRELGMRFGLWVEPEMVNPDSDLYRAHPDWVLHLPDRSRSE
LRNQLVLNFARRDVADWAYGWLTELVGAHRIDFLKWDMNRAFSEAGWPGQQDGADRLGTQ
YVRHLYGVIDRLRADHPGLRIESCSGGGGRIDLGILGRTDQTWASDNTDAADRLWIQHGF
SQIYPARTMGCWVTDAPNQFTGRGLPLRFRFHAAMAGALGIGGDLARWSEEELREGAALV
TEYKKVRHLVQHGRLDRLSPPSGQSPAVVQYTSADGSESLVLAWRGVPRPGDADLPVRLR
ALTPAARYRDSRTGTVHHASVLGDYGLRLDLPAGDWSSVAMHLVREPEAV
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgtcgctgatctccttcgccccgcacagcggggtctggctgctgaccaccccgcacacg
tcgtacgcactacggatcgacgcgtcgggtgccccctgccatctcgcgtggggaccgagg
ctgacgctcgcggcggccgaggaactcgccgtccccgagccacccgctgccagcagcttc
gagggcagaccgagtgtgggagaggaactccccgtcgacggcggggtccgctacgggccg
ccgtcgcttcaggtgcgcttcgcggacgggagccgcgccttcgaatggcagcccaccggc
caccgggtgcacgagagcgccgacggcgcgcacgagctggtcctgttcttccgcgaccgc
cgctaccccttgcaggtggcgctgcattaccgggtgcgcgccgacaccgacgtcatcgaa
cggtggacggtcgtgcgcaacggcggggacgagcccgtgaccctgctgcgcgccgactcg
gccgcctggacccttcccccgctggcggactaccggctcagccatgtcaccgggcagtgg
tccgccgagagccggctgcgccgcgaccgactgccgtacggcgagaccgtgctgaccagc
cgtcgcggcatcaccagccatcacacgaacccctggctgatggtcgactccggtgaggcc
acggaggaccacggccgggtctggagcgcggcgctcgcctggagcgggagctggcgcatc
accacacagcgcaccccggacgggcggaccggcttcaccggaggcgtcgggcacgacggc
acgggcgtaccgctgactccgggcgaggagttcaccgctcccgcgttcgccggcctgttc
accgccgacggcttcggcgcggccagtcgtgcctggcacgcgtacacgctggcccatgtg
ctgccccacccggacgaaccggtgccggtgctctacaactcgtgggaggccacgggcttc
gatgtcgacgaggtcggccagaaggcgctcgcggaacgggccgccgccctcggcgtcgag
ttgtacgtcgtcgacgacggctggttcggcgggcgccgcagcgaccgggccgggctcggt
gactggactcccgctcccgaccgcttccccgacggactgggcccgctggccgacagggtg
cgcgaactggggatgcgcttcgggctgtgggtggagcccgaaatggtcaacccggacagc
gacctgtaccgggcgcacccggactgggtactgcacctgcccgaccgctcccgctcggag
ctgcgcaaccagctcgtcctcaacttcgcccgccgcgacgtcgccgactgggcgtacggc
tggctgaccgaactcgtcggcgcccaccggatcgacttcctcaagtgggacatgaaccgc
gccttcagcgaagccggctggccggggcagcaggacggcgcggaccggctcggcacgcag
tacgtgcgccatctctacggggtgatcgaccgtctccgcgcggaccacccggggctgcgg
atcgagtcgtgcagcgggggcggcggccggatcgacctcgggatcctggggcgtacggac
cagacatgggcctcggacaacaccgatgccgccgaccggctgtggatccagcacggattc
agccagatctatcccgcgcgcaccatggggtgctgggtgaccgacgcgcccaaccagttc
accggccgtgggctcccgctgcggttccgcttccacgccgcgatggcgggggcgctgggc
atcggcggggatctggcgcgctggtcggaggaggaactgcgggaaggggccgcgctggtc
accgagtacaagaaggtgcgccatctcgtgcagcacggcaggctcgatcggctgtcgccg
ccttccggccagtcgcccgcggtcgtgcagtacacctcggcggacggctcggagtcactg
gtgctcgcctggcgcggcgtcccgcgtcccggcgacgccgacctgccggtacggctgagg
gcactgactccggcggcccggtaccgcgacagccgcaccggcaccgtgcaccatgcctcc
gtcctgggcgactacggcctgcgcctcgacctgccggccggcgactggtccagcgtggcg
atgcatctcgtacgggagccggaggcggtctga

KEGG   Streptomyces avermitilis: SAVERM_1475
Entry
SAVERM_1475       CDS       T00126                                 

Gene name
agaB2
Definition
(GenBank) putative alpha-galactosidase, secreted
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
sma  Streptomyces avermitilis
Pathway
sma00052  Galactose metabolism
sma00561  Glycerolipid metabolism
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SAVERM_1475 (agaB2)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_1475 (agaB2)
   00600 Sphingolipid metabolism
    SAVERM_1475 (agaB2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SAVERM_1475 (agaB2)
SSDB
Motif
Pfam: Melibiase_2 NPCBM NPCBM_assoc Melibiase_C Melibiase PsbQ
Other DBs
NCBI-ProteinID: BAC69185
NITE: SAV1475
UniProt: Q82N28
Position
1817779..1819827
AA seq 682 aa
MRHPYARTTRTTRTTRTTRRRVVGALTAGLLCTAGLAAPALAAPAAGPVSPRPADSLALT
PPMGFNNWNSTGCRPEFNEDMVKGTADIFVEKGLKDAGYQYVNLDDCWALPARDSNGKLV
PDPARFPGGIKAVADYVHSKGLKLGIYTSAGTKTCNEAGFPGALGHEYSDAQQFADWGVD
YLKYDNCNNQGVDAKLRYTTMRDALKATGRPIVYSLCEWGENKPWEWASDVGQLWRTTGD
ISDSWGSMLSILKQNLPLAPYAGPGHWNDPDMLEVGNSGMTDTEYRTHFSMWSIMAAPLL
IGSDLRKASAATFDILDNKEVIAVDQDPLGKQGTVLSSEGGRWAVTKEMKDGSRAVALFN
ETDSAQRITTTAQAVGLPKAHAYTLRDLWQHRSYNTAGTISATVPAHGTVLVRVSADAAW
AKNPPAVELGVDGSPLLEAGRTVALTSALTDLGRTPAKRVSVTLSGPRGWRVRATSPTTA
GTVPTGRSLRTKWKVTAPDGTAAGSYDLTLKATYRSPTGVRAETLVPLAASVVPAPPSGV
SYLGDLPWMSTTNGWGPVERNTSNGESAAGDGRPITVDGVVHAKGIGVHAESTIAYYTGR
SCETVTADVGVDDEQDTNGSVTFEIWADGTRVASTGVLTTAMPARPLSADVTGAQVVRLV
VTDGGNGITSDHADWADAKLSC
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgcgtcacccctacgcccgcacaacccgcacaacccgcacaacccgcacaacccgccga
agagtcgtcggagcgctcaccgcaggactgttgtgtacggccgggctcgcggcgccggcc
ctcgccgctcccgccgccggtccggtctcgccccggccggccgacagcctcgccctcacc
ccgccgatgggcttcaacaactggaactccacgggatgccgaccggagttcaacgaggac
atggtcaaggggacagccgacatcttcgtcgagaagggtctcaaggacgccgggtaccag
tacgtcaacctggacgattgctgggccctgccggcccgggactcgaacggcaagttggtg
ccggatcccgctcgattcccgggtggaatcaaggcggttgccgactatgtgcactccaaa
gggctcaagctcggcatctacaccagcgcgggcaccaagacatgcaacgaagccggtttc
ccgggcgcgctgggccacgagtacagcgacgcccaacagttcgcggactggggcgtcgac
tacctcaagtacgacaactgcaacaaccagggtgtcgacgcgaagctccgctacaccacg
atgcgtgacgcgctgaaggccacggggcgccccatcgtctacagcctctgcgagtggggc
gagaacaagccctgggagtgggcgtcggacgtcggacagctgtggcgtacgaccggggac
atcagcgacagttggggctcgatgctgtcgatcctcaagcagaatctgcccctcgcgccg
tacgccggtcccggccactggaacgacccggacatgctggaggtcggcaacagcggcatg
accgacaccgagtaccgcacccacttctcgatgtggtcgatcatggccgcgccgctgctc
atcggctcggacctgcgcaaggcgtccgccgcgaccttcgacatcctcgacaacaaggag
gtcatcgccgtcgaccaggacccgctgggcaagcagggcacggtgctctcctccgagggc
ggacgctgggccgtcaccaaggagatgaaggacggcagccgggcggtggccctcttcaac
gagacggacagcgcacagcggatcaccaccaccgcgcaggccgtaggactgccgaaggca
cacgcgtacacgctgcgcgatctgtggcagcacaggagctacaacaccgccggcacgatc
tcggcgaccgtcccggcgcacgggacggtcctcgtacgggtctcggccgacgccgcatgg
gccaagaacccgcccgccgtcgaactgggcgtggacggcagcccgttgctggaggcgggc
aggacggtcgccctgacctcggcgctcaccgacctcggccgtacgcccgcgaagcgtgtc
tccgtgacactgagcgggccccgggggtggcgggtgagggcgacctcgccgaccaccgcg
ggcacggtgccgacaggccgttcgctgcgcacgaagtggaaggtcaccgcgcccgacggc
acggccgccggctcgtacgacctgacgctgaaggcgacctaccgctcgccgacgggggta
cgcgccgagaccctggtgccgctcgcggcgtccgtggtgccggccccgccctcgggcgtc
tcctacctcggggacctgccctggatgtcgacgaccaacggctggggcccggtggagcgc
aacaccagcaacggtgagagcgccgccggcgacggtcgtccgatcactgtcgacggcgtc
gtccacgccaaggggatcggtgtgcacgccgagagcaccatcgcgtactacaccggcagg
tcgtgcgagacagtcaccgcggacgtgggggtcgacgacgagcaggacaccaatggcagc
gtcaccttcgagatctgggcggacggcaccagagtcgcctcgaccggggtcctgaccacc
gcgatgccggcgcgaccgctctcggccgatgtgaccggcgcccaggtggtccggctggtc
gtcaccgacggcggcaacggcatcacctcggaccacgcggactgggcggacgccaagctc
agctgctga

KEGG   Streptomyces avermitilis: SAVERM_1641
Entry
SAVERM_1641       CDS       T00126                                 

Gene name
agaB3
Definition
(GenBank) putative alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
sma  Streptomyces avermitilis
Pathway
sma00052  Galactose metabolism
sma00561  Glycerolipid metabolism
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SAVERM_1641 (agaB3)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_1641 (agaB3)
   00600 Sphingolipid metabolism
    SAVERM_1641 (agaB3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SAVERM_1641 (agaB3)
SSDB
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31
Other DBs
NCBI-ProteinID: BAC69352
NITE: SAV1641
UniProt: Q82ML9
Position
complement(2010083..2012185)
AA seq 700 aa
MSTSVDICGGLMVEIAEDRRTWLLSGPTSSYAVHLTEGHELLHLHWGPRIALADAEALAA
LPAPGGSSFESPLDGREEYPVEGGPRFVRPALSVRTDERRGTEWRFEAYETEGDELRLRF
GDSGLAVTLHYRMRDDVVERWVTLANDGPALELLRADSATWTLPERDGWRLSQLHGRWAA
ESRLVRSDLTYGEKIIGSRRGHTGHQHLPWVALDCEATEESGEVYGCALGWSGSWRISVA
QLSDARVQITGGAGYDDSGLLRLGPGESFTTPVFAGLWSDGGFGGASRAWHAYQRAYVIP
DADQDRPVLFNSWEATTFDISEEQQGALARRAAAMGVELFVVDDGWFGARTGDRAGLGDW
TPNPDRFPAGLKPLADYVHALGMQFGIWVEPEMVNPDSELYRAHPDWVQFQPGRTRTEFR
NQLVLNLAREDVQQCLWEQLDGLLSSAPVDYVKWDFNRCFTDAGWPGEAYPQRLWVDHVR
ALYRLLDRLRAAHPGVAFESCSGGGGRIDLGIMARTDQVWTSDNTDPLDRLAIQHGFSQI
HPARVMAAWVTDSPNTQLNGRVSTLRLRFVSAMAGVLGVGGDLAEWSERELVEARDWVSL
YKEIRPVVQRGDLYRLRPPTGGLSAVQYVHGDEAVVLAWLQAQHYGEPVAPLRLRGLDPA
ATYECRETGEVHRGAVLLHHGLRTGLHGDLDATVVRLRRI
NT seq 2103 nt   +upstreamnt  +downstreamnt
ttgagtacatctgttgacatctgtgggggcctgatggttgagatcgccgaagaccgacgt
acgtggcttctttcggggcccacgagcagctacgccgtgcatctcaccgagggtcacgaa
ctgctgcatctgcactggggcccgcggatcgccctcgccgacgccgaggccctcgccgcc
ctccccgccccgggcggctcgtccttcgaatcgccgctggacgggcgtgaggagtacccg
gtcgagggcggcccccgcttcgtacgcccggcgctgtccgtgcgcaccgacgagcgccgt
ggcaccgagtggcgcttcgaggcgtacgagaccgaaggcgacgagctgcggctgcggttc
ggcgactcggggctggccgtcacgctgcactaccggatgcgggacgacgtcgtcgagcgc
tgggtgacgctggccaacgacggacccgccctggagctgctgcgcgccgactccgccacc
tggaccctgcccgagcgcgacggctggcggctgtcccagctgcacgggcgctgggcggcc
gagtcccgcctcgtacgctcggacctcacctacggcgagaagatcatcggcagccggcgc
gggcacaccgggcaccagcatctgccgtgggtcgcgctcgattgcgaggcgaccgaggag
agcggcgaggtctacggctgcgcgctcggctggtccggctcctggcgcatctcggtggcc
caactctccgacgcgcgcgtgcagatcaccggcggcgcggggtacgacgactcgggcctg
ctgcgcctggggccgggggagtcgttcacgacgcccgtcttcgcggggctgtggagcgac
ggcggcttcggcggcgcgagccgcgcctggcacgcgtaccagcgggcgtacgtcatcccg
gacgcggaccaggaccgtccggtgctcttcaattcctgggaggccaccaccttcgacatc
tccgaggaacagcagggggctctcgcgcggcgggccgcggcgatgggggtcgagctgttc
gtggtcgacgacggctggttcggggcgcggaccggcgaccgggccgggctcggcgactgg
acgcccaaccccgaccgcttcccggccgggctcaagccgctcgccgactacgtgcacgcg
ctcggcatgcagttcggcatctgggtcgagcccgagatggtcaacccggacagcgagctg
taccgcgcgcacccggactgggtgcagttccagccggggcggaccaggacggaattccgc
aaccagctggtcctcaacctcgcgcgcgaggacgtccagcagtgcctctgggagcagctc
gacggactgctgtccagcgcccccgtcgactacgtgaagtgggacttcaaccgctgcttc
acggacgccggctggcctggggaggcatatccgcagcggctctgggtcgatcatgtgcgc
gccctgtaccgcctgctggaccggctgcgggccgcgcatccgggggtcgccttcgagtcc
tgctcgggcggtggcggccggatcgacctgggcatcatggcgcgtacggaccaggtgtgg
acctccgacaacaccgacccgctcgaccggctcgccatccagcacggattcagccagatc
caccccgcccgggtcatggccgcctgggtcaccgacagcccgaacacacagctcaacggg
cgagtcagcacgctgcgcctccggttcgtcagcgccatggcgggagtgctcggggtcggc
ggcgatctggccgagtggagcgagcgggaactcgtcgaggcacgggactgggtgagtctc
tacaaggagatccggcccgtcgtgcagcgcggggacctctaccggctgcggcccccgacg
ggcgggctgagcgccgtgcagtacgtccacggcgacgaggccgtcgtcctcgcctggctc
caggcccagcactacggcgagccggtcgccccgctccggctgcgcggcctcgacccggca
gccacctatgaatgccgtgaaacgggcgaagtgcaccgaggtgccgtactgctgcatcac
gggctgcggacggggttgcacggggacctcgatgcgacggttgttcggctacgtcgcatt
tga

DBGET integrated database retrieval system