KEGG   Streptomyces avermitilis: SAVERM_1138Help
Entry
SAVERM_1138       CDS       T00126                                 

Gene name
rnhA
Definition
(GenBank) putative ribonuclease H
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_1138 (rnhA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_1138 (rnhA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     SAVERM_1138 (rnhA)
DNA replication proteins [BR:sma03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    SAVERM_1138 (rnhA)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     SAVERM_1138 (rnhA)
   Elongation factors (archaeal)
     SAVERM_1138 (rnhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_H RVT_3 Fungal_KA1
Motif
Other DBs
NCBI-ProteinID: BAC68848
NITE: SAV1138
UniProt: Q79ZK0
Position
complement(1426227..1426937)
Genome map
AA seq 236 aa AA seqDB search
MIGGMSERVVAACDGASKGNPGPAGWAWVVADGEETPTRWAAGALGTATNNVAELTALER
LLSAMDPDVPLEIRMDSQYAMKAVTTWLPGWKRKGWKTAAGKPVANQELVARIDELLDGR
SVEFRYVPAHQVDGDRLNDFADRAASQAAIVQEPAGSEYGSPEPPKSPDTVAAGSAGRGA
PAKKRASARTAKTSTRTIKAKFPGRCVCGRPYAAGEPIAKNAQGWGHPECRTADDV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggggcatgtctgaacgtgtggtggccgcctgtgacggggcgtcgaagggaaac
cccggaccggccggatgggcctgggtcgtcgccgacggcgaggagaccccgacccgctgg
gcggccggggcgctcggcacggccacgaacaacgtggccgaactcaccgcgctggagcgc
ttgttgagcgcgatggatccggacgtcccgctggagatccggatggactcccagtacgcg
atgaaggccgtcacgacctggctgcccggctggaagcgcaagggctggaagacggccgcg
gggaagccggtcgccaaccaggaactggtcgcccgcatcgacgaactgctcgacggacgc
tccgtcgagttccgttacgtccccgcgcaccaggtcgacggcgaccggctcaacgacttc
gccgaccgtgccgccagccaggcggcgatcgtccaggaaccggcgggcagcgagtacggc
tccccggagccgccgaagtcgcccgacaccgtcgcggccggctccgcgggtcgcggcgct
cccgccaagaagcgtgcctccgcgcgcaccgccaagacgagcacgcgcacgatcaaggcg
aagttccccggccgctgtgtctgcggccgcccctacgcggcgggcgagcccatcgccaag
aacgcgcagggctggggccacccggagtgccgtaccgccgacgacgtctag

KEGG   Streptomyces avermitilis: SAVERM_5877Help
Entry
SAVERM_5877       CDS       T00126                                 

Definition
(GenBank) putative bifunctional protein (ribonuclease H/phosphoglycerate mutase)
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
sma  Streptomyces avermitilis
Pathway
sma00860  Porphyrin and chlorophyll metabolism
sma01100  Metabolic pathways
sma03030  DNA replication
Module
sma_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAVERM_5877
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_5877
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_5877
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     SAVERM_5877
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     SAVERM_5877
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     SAVERM_5877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: BAC73589
NITE: SAV5877
UniProt: Q82B28
Position
7086857..7088173
Genome map
AA seq 438 aa AA seqDB search
MVREFIVEADGGSRGNPGPAGYGAVVIDAATGETLAETAEYIGVATNNVAEYRGLLAGLK
AARALDPAARIRVRMDSKLVVEQMSGRWKIKHPDMKPLAREAAAVFPPSQVTYEWIPRER
NKHADRLANEAMDAGKRGERWSPSTSTAELSARTPAPAAPEPTGPPGDAAAGAARARAAL
AGGRVATSPAVPEPGGTAADTGARAARDVASVPADADVRAARNVASPPADLGAPATFVLL
RHGETPLTPQKRFSGSGGSDPALSDVGRRQAELVGAALAARGTIQAVVSSPLARCRETAG
IVAARLGIEVSVEEGLRETDFGAWEGLTFGEVRERHPEDMNAWLADPEAEPTGGGESFAA
VARRVATTRDKLLAAYAGRTVLLVSHVTPIKTLVRLALDAPPQSLFRMELSAASVSAVAY
YADGNASVRLLNDTSHLR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgggagttcatcgtcgaggccgacggcggttcccggggcaacccggggcccgcg
ggctacggcgccgtggtgatcgacgcggcgacgggcgagacgctggcggagacggccgag
tacatcggcgtcgccacgaacaacgtggccgagtaccgggggctgctggccgggctgaag
gcggcccgcgccctggacccggccgcccggatccgcgtccgcatggactccaaactcgtg
gtcgagcagatgtcgggccgatggaagatcaagcaccccgacatgaagccgctggcgagg
gaagcggcggcggtcttcccgccgtcacaggtcacgtacgagtggattccgcgcgagcgg
aacaagcacgccgaccggctcgcgaacgaggcgatggacgccggcaagcggggggagcgg
tggtccccgtcgacgtccaccgcggaactgtccgcccggacgccggcccccgcggccccc
gagccgacggggccacccggagacgcggcggcgggcgcggccagggctcgggcggcgctg
gccggtggacgcgtggcgacgagccctgcggtccctgaaccgggcggcaccgctgccgac
accggcgcgcgggccgcgcgcgatgttgcctccgtgccggccgatgctgacgtgcgggcc
gcgcgcaacgtcgcgtccccgcccgccgacctcggcgcccccgccaccttcgtgctgttg
cggcacggggagaccccgctgacgccgcagaagcggttctcggggagcggtggcagtgat
ccggccctctccgacgtgggccgccggcaggccgaactcgtcggtgccgccctcgccgca
cgcggcaccatccaggccgtcgtgtcctcgccgctggcccgctgccgcgagaccgccggg
atcgtcgccgcccgcctcggtatcgaggtgagcgtcgaggaggggctgcgcgagaccgac
ttcggcgcctgggaggggctgaccttcggcgaggtgcgcgagcgccaccccgaggacatg
aacgcctggctggccgacccggaggccgagcccaccggcggcggggagagcttcgccgcc
gtcgcccggcgcgtcgccaccacccgcgacaagctcctcgccgcgtacgcgggccgcacg
gtcctgctcgtctcgcacgtcacgccgatcaagaccctcgtacgactcgccctcgacgcg
cccccgcagtccctgttccggatggaactgtcggcggcctccgtctcggccgtggcgtac
tacgcggacggaaacgcgtccgtgcgtctgctgaacgacacgtcgcacctccgctga

DBGET integrated database retrieval system