KEGG   Streptomyces avermitilis: SAVERM_1141
Entry
SAVERM_1141       CDS       T00126                                 

Gene name
adhA1
Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00071  Fatty acid degradation
sma00350  Tyrosine metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00626  Naphthalene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1141 (adhA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1141 (adhA1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_1141 (adhA1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_1141 (adhA1)
   00626 Naphthalene degradation
    SAVERM_1141 (adhA1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAVERM_1141 (adhA1)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Other DBs
NCBI-ProteinID: BAC68851
NITE: SAV1141
UniProt: Q82NZ9
Position
1428660..1429664
AA seq 334 aa
MWAWEVERPGPIEDGPLRFVERPVPVPGPGELLVRVRACGVCRTDLHVSEGDLPVHRPRV
TPGHEVVGVVAGRGADAGGYAVGDRVGVAWLRRTDGTCRYCVRGAENLCPASEYTGWDTD
GGYAEYTTVPAAFAYRLPTDVDDVALAPLLCAGIIGYRALVRASLPPGGRLGLYGFGGSA
HLCAQVALAQGATVHVLTRDPASQRLALALGAASAGGAYDTPPEPLDSAILFAPAGGLVP
VALRALDRGGVLSVAGIHLSDTPPLCYERELFYEKELRSVTSNTRADGREFLELAARYGV
RATTHTYPLSEAQQALRDLKAGRFDGAAVLVNDV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtgggcatgggaagtggagcggccgggtccgatcgaggacggtccgctgcggttcgtg
gagcggccggtcccggtaccgggacccggtgagctgctcgtgcgggtgcgcgcctgcggg
gtgtgccgtaccgacctgcacgtcagcgagggcgacctgccggtgcaccggccccgggtg
acacccgggcacgaggtcgtgggcgtggtggcgggacggggcgcggacgccggcggctac
gcggtcggggaccgggtgggggtggcctggctgcgccgtacggacggcacctgccggtac
tgcgtgcgcggggccgagaacctctgtccggcgtccgagtacaccggatgggacacggac
ggcggctacgccgagtacacgaccgtcccggccgcgttcgcgtaccggctgcccaccgac
gtcgacgacgtggcgctggcgccgctgctgtgcgcgggcatcatcggctaccgggcgctg
gtgcgggcgtcgctgccaccgggcgggcgactcggtctgtacgggttcggcggcagtgcc
cacctgtgcgcacaggtcgcgctcgcacagggcgccaccgtgcacgtactgacccgggac
ccggcctcgcagcggctcgcgctcgccctcggggccgcctcggcgggcggggcgtacgac
accccgccggagccgctggacagcgcgatcctgttcgcgccggccggcggtctggtgccg
gtcgcgctgcgggccctggaccgcggcggggtgctgtcggtcgccggcatccatctgagc
gacaccccgccgctgtgctacgaacgcgagctgttctacgagaaggagctgcgcagcgtc
acctcgaacacgcgcgcggacggccgggagttcctggagctggcggcccggtacggggtc
cgggccacgacgcacacctatcccttgtccgaggcgcagcaggccctgcgggatctgaag
gcgggccgcttcgacggggcggccgtcctggtcaacgacgtctga

KEGG   Streptomyces avermitilis: SAVERM_1357
Entry
SAVERM_1357       CDS       T00126                                 

Gene name
adhA2
Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00071  Fatty acid degradation
sma00350  Tyrosine metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00626  Naphthalene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1357 (adhA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1357 (adhA2)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_1357 (adhA2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_1357 (adhA2)
   00626 Naphthalene degradation
    SAVERM_1357 (adhA2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAVERM_1357 (adhA2)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NADH_4Fe-4S
Other DBs
NCBI-ProteinID: BAC69067
NITE: SAV1357
UniProt: Q82NE6
Position
1673000..1674022
AA seq 340 aa
MSTYRAAQVAAASGPFEIVQREVPRPGPGHVRIAVDACGICHSDSVFVDALLPGVRFPLV
PGHEIAGHIDELGEGTDISWQVGDRVAVGWFGGSCGHCPPCRQGDFVVCQNLKVPGWAYD
GGYAEAVIAPADALARIPDALAATDAAPLGCAGVTTYNGLRRSSARPGDLVAVLGIGGLG
HLGVKYAAAMGFETVAIARGSDKADFAKQLGAHHYIDSTADTTVADALQSLGGAKAVLAT
AANSDAITATVDGLAPRGELVAIGVDAEPLGISPNQLLMGGKIIRGHPSGTAQDVQDTMA
FSALHGIRPMTETVPLDQADEAYRKMMSGAARFRMVLTTG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtacttatcgagcagcgcaggtggccgccgcgagcggtccgttcgagatcgtccag
cgtgaggtgccgcggcccggccccggccatgtccggatcgccgtggacgcctgcgggatc
tgccacagcgactccgtcttcgtcgacgccctgttgccgggcgtccggtttccgctggtc
cccgggcatgagatcgccgggcacatcgacgagctcggcgagggaacggacatcagctgg
caggtgggcgaccgggtggcggtgggctggttcggcggcagctgcggccactgcccgccc
tgcagacagggcgacttcgtcgtgtgccagaacctgaaggtccccggatgggcgtacgac
ggaggctacgccgaggcggtgatcgcaccggccgacgccctggcccggatccccgacgcg
ctggcggcgaccgacgcggcacccctgggctgcgcgggagtgaccacgtacaacgggctg
cgacgcagctccgcgcggccgggcgatctcgtcgccgtcctcggcatcggtggcctcggc
cacctgggggtgaagtacgcggccgccatgggcttcgagaccgtggccatcgcccgcgga
tccgacaaggccgacttcgccaagcagctcggcgcacaccactacatcgacagcacggcg
gacaccaccgtcgcggatgcgctgcagtccctcggcggcgccaaggccgtgctggccacc
gccgccaactcggacgccatcacggcgaccgtggatgggctcgcgccccgcggcgagctg
gtggccatcggtgtggacgccgagccgctgggcatcagcccgaaccagctgctcatgggc
ggcaagatcatccgcggtcatccgtccggcaccgcgcaggacgtgcaggacaccatggcg
ttcagcgccctgcacgggatccggccgatgaccgagaccgtgccgctggaccaggccgat
gaggcgtaccggaagatgatgtccggcgccgcccgcttccgcatggtgctcaccaccggc
tga

KEGG   Streptomyces avermitilis: SAVERM_3833
Entry
SAVERM_3833       CDS       T00126                                 

Gene name
adhA6
Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00071  Fatty acid degradation
sma00350  Tyrosine metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00626  Naphthalene degradation
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3833 (adhA6)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_3833 (adhA6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_3833 (adhA6)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_3833 (adhA6)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_3833 (adhA6)
   00626 Naphthalene degradation
    SAVERM_3833 (adhA6)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAVERM_3833 (adhA6)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     SAVERM_3833 (adhA6)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DUF3419
Other DBs
NCBI-ProteinID: BAC71545
NITE: SAV3833
UniProt: Q82GR4
Position
complement(4736424..4737473)
AA seq 349 aa
MRGVVFDGKQTQVVDDLEIREPGPGEVAVAISAAGLCHSDLSVVDGTIPFPVPVVLGHEG
AGVVEAVGSGVTHVRPGDHVALSTLANCGACAECDRGRPTMCRKAIGRPQQPFARGGRPL
YQFAANSAFAERTVVKAVQAVRIPKDIPLPSAALIGCGVLTGVGAVLNRARVEHGDSVLV
IGTGGIGLNVLQGARIAGALTIVAVDANPAKEAVARQFGATHFLTSTEGVRDILPTGADH
AFECVGRAALIRQAVDLLDRHGQAVLLGVPPATAEASFLVSSLFLDKSILGCRYGSSRPQ
RDIALYADLYREGRLLLDELVTATYPVEDFEKAAADAHEGRVARAVLTF
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcgcggagtggtcttcgacggaaagcagacccaggtcgtggacgatctggagatacgg
gagccgggacccggcgaggtggcggtggcgatctccgcggccgggctctgccacagcgat
ctgtccgtggtggacgggaccataccgttcccggttcctgtggtgctgggccatgagggc
gcgggggtggtggaggccgtgggcagtggcgtcacccatgtccggcccggagaccatgtg
gcgctgtccacgctcgcgaactgcggtgcgtgcgcggagtgcgaccgggggcggccgacg
atgtgccgcaaggcgatcgggcggccgcagcagccgttcgcgcgcggcggccggccgctg
taccagttcgcggccaactcggccttcgcggaacggaccgtggtgaaggcggtgcaggcc
gtccggatcccgaaggacattcccctgccctccgcggcgctgatcggctgcggggtgctg
acgggcgtgggcgccgtgctcaaccgcgcgcgcgtggagcacggcgacagcgtgctggtc
atcggcacgggcgggatcggcctcaatgtcctccagggcgcgcggatcgcgggtgccctg
acgatcgtcgcggtggacgcgaacccggcgaaggaggcggtggcccgccagttcggcgcg
acgcacttcctgacctcgacggagggggtgagggacatcctgcccacgggcgcggaccac
gccttcgagtgcgtgggccgggccgcactcatccgtcaggccgtcgacctgctggaccgc
cacggccaggcggtgctcctcggcgtaccgcccgcgacggccgaggcgtccttcctcgtc
tcctcgctgttcctggacaagtcgatcctcggctgccgctacgggtcctcgcggccgcag
cgggacatcgcgctctacgcggacctctaccgggagggccggctgctgctggacgagttg
gtcacggcgacgtaccccgtggaggacttcgagaaggcggcggccgacgcgcatgagggg
agggtggcgcgggcggtgctgacgttctga

KEGG   Streptomyces avermitilis: SAVERM_5335
Entry
SAVERM_5335       CDS       T00126                                 

Definition
(GenBank) putative oxidoreductase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00071  Fatty acid degradation
sma00350  Tyrosine metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00626  Naphthalene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_5335
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_5335
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_5335
   00626 Naphthalene degradation
    SAVERM_5335
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAVERM_5335
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 Methyltransf_12 Methyltransf_11 2-Hacid_dh_C 3HCDH_N UDPG_MGDP_dh_N NTPase_P4 MTS Urocanase
Other DBs
NCBI-ProteinID: BAC73047
NITE: SAV5335
UniProt: Q82CL0
Position
6466793..6467836
AA seq 347 aa
MRAVVFERFGEPAEVREVADPEPSEHGVVVRVEATGLCRSDWHGWVGHDPDITLPHVPGH
ELAGVVEAVGTRVSGWRPGDRVTVPFVCACGSCAACAAGDQQVCERQAQPGFTHWGSFAQ
YVALEHADVNLVAMPDELSFGTAAALGCRFATAFRAVVAQGRVAAGEWVAVHGCGGVGLS
AVMIAAASGARVVAVDVSPQALDLARKFGAAASVDASRVEDTAAAVRELTGGGAHLSLDA
LGSPVTCVASVNGLRRRGRHVQVGLLPSSTGSTPVPMARVIGLELEVLGSHGMAAHAYPP
MLELVRAGVLRPDLLVTSAIPLDTAPIALAAMGTAPGAGVTVIEPWR
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcgtgcggtggtgttcgagcggttcggggagccggccgaggtgcgggaggtggcggat
ccggagccctcggagcacggggtcgtggtgcgggtcgaggcgaccgggttgtgccggagc
gactggcacgggtgggtggggcacgacccggacatcacgctgccgcatgtgccggggcac
gaactcgcgggcgtggtcgaggcggtgggcacccgggtgagcgggtggcggcccggcgac
cgggtcaccgtaccgttcgtctgcgcctgcggaagctgcgccgcgtgcgcggcgggcgat
cagcaggtgtgcgagcggcaggcccagccgggattcacgcactggggctccttcgcgcag
tacgtggcgctggagcacgcggacgtgaacctggtcgcgatgccggacgagctgtcgttc
gggacggcggcggcgctgggctgccggttcgccacggcgttccgggcggtggtggcgcag
ggcagggtggcggcgggggagtgggtcgccgtgcacggctgcggcggcgtcggactgtcg
gcggtgatgatcgcggcggcctccggcgcccgcgtcgtcgccgtcgacgtctcgccccaa
gccctcgacctggcacggaagttcggcgcggccgcgagtgtggacgcctcgcgcgtcgag
gacacggcggcggcggtccgtgagctgaccggcggcggcgcccatctctccctcgacgcg
ctcggctcacccgtcacctgcgtggcttcggtgaacgggctgcgccgccgcggccggcac
gtccaggtgggcctgctgccctcgtccaccggctccaccccggtccccatggcccgggtg
atcggcctcgaactcgaggtcctcggcagccacggcatggcggcgcacgcctacccgccg
atgctggagctggtgcgcgcgggggtgctgcgccccgacctcctggtcacctcggcgatc
ccgctggacacggccccgatagcgctggcggccatggggacggccccgggggcgggggtg
acggtcatcgaaccgtggcgctga

KEGG   Streptomyces avermitilis: SAVERM_5871
Entry
SAVERM_5871       CDS       T00126                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00071  Fatty acid degradation
sma00350  Tyrosine metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00626  Naphthalene degradation
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5871
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_5871
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_5871
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_5871
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_5871
   00626 Naphthalene degradation
    SAVERM_5871
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAVERM_5871
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     SAVERM_5871
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DUF2249 2-Hacid_dh_C AlaDh_PNT_C
Other DBs
NCBI-ProteinID: BAC73583
NITE: SAV5871
UniProt: Q82B34
Position
7081196..7082272
AA seq 358 aa
MRAAVLHEIGQDKLEVLDDVESVGFGPGRVRIRVRATGLCHSDLSAMSGVLPQPAPFVPG
HEGAGEIVEVGEGVSHLKPGDRVVVCWLPACGVCPACKRGQSQLCLAGFMNAGTPNFRRP
GGDVFGFAGTGTFAEEVVVDAGSAVPIPDDVPFDIAALIGCGVTTGLGAALNTADVAAGS
SVAVIGCGGVGISAVQGARLKGAAEIVAVDPVASRRESALRFGATQAVSPDELAAAKQAV
TGGEGFDYVFEVVGRSATARTAYENTRRGGTLVVVGAGALDDFLQLNMFELFFDEKRILP
SMYGGGDVLRSYERTIALWRAGRIDLEGLITHRVPLAEINEALDQMRTGTALRTCIEI
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcgcgcagccgtactgcacgagatcggccaggacaagctcgaagtcctcgacgacgtc
gagtcggtgggcttcgggcccggcagggtgaggatccgggtgcgggccaccggactgtgt
cactcggacctgtccgcgatgagcggcgtactgccgcagcccgcgccgttcgtacccggg
cacgagggcgccggcgagatcgtcgaggtcggcgaaggcgtcagccacctgaagcccggc
gaccgggtcgtcgtgtgctggctgcccgcctgcggggtctgtcccgcctgcaagcgcggc
cagagccagctgtgtctggccgggttcatgaacgcgggcacgcccaacttcaggcgcccc
ggcggtgatgtcttcggcttcgcgggcaccggcaccttcgccgaggaggtcgtcgtcgac
gcgggcagcgccgtgccgatcccggacgacgtgcccttcgacatcgccgccctcatcggc
tgcggggtgaccacgggactgggcgccgccctcaacaccgcggacgtggcggccggttcg
tcggtcgccgtcatcggctgcggcggcgtcggcatctccgccgtccagggcgcccgcctc
aagggcgcggccgagatcgtcgccgtcgacccggtcgcctcccgccgtgagtccgcgctc
aggttcggtgccacgcaggcggtgtcgccggacgagctggccgcggccaagcaggcggtg
accggcggcgagggcttcgactacgtcttcgaggtcgtcggcaggtcggccacggcccgg
accgcgtacgagaacacccggcgcggcggcacactcgtcgtcgtcggcgcgggcgcgctg
gacgacttcctccagctcaacatgttcgagctgttcttcgacgagaagcggatcctgccc
tcgatgtacggcggcggcgacgtgctgcgctcgtacgaacggaccatcgcgctgtggcgt
gccggacgcatcgacctggagggcctgatcacccaccgggtgccgctcgccgagatcaac
gaggccctcgaccagatgcggacgggcaccgccctgcgtacctgcatcgagatctga

KEGG   Streptomyces avermitilis: SAVERM_7169
Entry
SAVERM_7169       CDS       T00126                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00071  Fatty acid degradation
sma00350  Tyrosine metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00626  Naphthalene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_7169
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_7169
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SAVERM_7169
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_7169
   00626 Naphthalene degradation
    SAVERM_7169
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAVERM_7169
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C Glu_dehyd_C ADH_N_assoc
Other DBs
NCBI-ProteinID: BAC74880
NITE: SAV7169
UniProt: Q826L9
Position
8535405..8536415
AA seq 336 aa
MRELTYTGRNTVEWREAPDPKLQSDQEAIVVPVAATSCDVDSMILAGHGFIDPPFALGHE
CVGRVVETGDAVTTVAPGDLVVVPWSINCGTCDNCRAGLTAHCTAVPHMAMYGAPIGGSW
GGLFSDLVRVPWADAMLVPLPAGLDPVAMASASDNWSLSWRLVAPHLKNKPGARVLVVAR
GSIGLYVCDIARALGASDILYVDPDPEHREIARGYGAATAETLEPFPHGFDIAVEATGRV
DQLALAVKSLAPEGICESAGNHFRPGELPLLDMYLTGVTLRIARDNVRNHIPDALELAAS
GKVAPERVVSHVLDWEQLPDALPEKHLKPVFVRADS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgcgtgaactgacctacaccggccggaacaccgtcgagtggcgcgaggcgcccgacccc
aagctccagtccgaccaggaggcgatcgtcgtgccggtggccgccacgtcctgcgacgtc
gactccatgatcctggccggtcacggcttcatcgacccgcccttcgccctcggtcacgaa
tgcgtgggccgggtcgtcgagaccggcgacgccgtcaccaccgtcgcccccggtgacctg
gtggtcgtcccctggtccatcaactgcggcacgtgcgacaactgccgcgccggactgacc
gcgcactgcacggccgtaccgcacatggccatgtacggcgcgccgatcggcggcagttgg
ggcggtctcttctccgacctggtccgcgtgccgtgggcggacgccatgctcgtacccctg
cccgccggcctcgacccggtcgccatggcctcggcgagcgacaactggtccctgtcgtgg
cgcctggtggccccccacctgaagaacaagcccggcgcccgcgtcctggtcgtcgcccgc
ggcagcatcggcctgtatgtctgcgacatcgcccgcgcgctcggcgcctccgacatcctg
tacgtcgacccggaccccgaacaccgcgagatcgcccgcggctacggcgccgccaccgcc
gagacgctcgagcccttcccgcatggcttcgacatcgccgtcgaggccaccggacgcgtc
gaccaactcgccctggccgtcaagtcccttgccccggaaggcatctgcgagtccgccggc
aaccacttccggcccggcgagctgcccctgctcgacatgtacctcaccggagtcaccctg
cgcatcgcccgcgacaacgtccgcaaccacatccccgacgccctcgaactcgccgcctcc
ggcaaggtcgcccccgagcgcgtcgtctcccacgtcctcgactgggagcaactccccgac
gcgctgcccgagaagcacctcaagcccgtcttcgtccgcgccgacagctga

DBGET integrated database retrieval system