KEGG   Streptomyces avermitilis: SAVERM_1172
Entry
SAVERM_1172       CDS       T00126                                 

Definition
(GenBank) putative oxidoreductase
  KO
K05275  pyridoxine 4-dehydrogenase [EC:1.1.1.65]
Organism
sma  Streptomyces avermitilis
Pathway
sma00750  Vitamin B6 metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_1172
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.65  pyridoxine 4-dehydrogenase
     SAVERM_1172
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-ProteinID: BAC68882
NITE: SAV1172
UniProt: Q82NW9
Position
complement(1461860..1462783)
AA seq 307 aa
MCHTPRMTSETITAEAAGTWKLGDLSVNRVGFGAMRLTGSAAFHLGTPSDRERSVTVLRR
ALELGVNHIDTAAFYFSSLRSANELINSALAPYPDDLVIVTKVGPYRDYTGEWGTAARPD
QLRGHVEENLRQLGRDHLDVVNLRRMRQDSIAEHFGALAELREAGLIRHLGISCVEPRHL
AEAQAIAPVVCVQNQYGLHSPDAGADTMLRMCGEQGIAFVPFFAIAGEGGAQGSSGSEDD
EIRAVARAHEATPAQVRLAWTLQQGPHVLAIPGTGNPDHLAANVAAGAIRLTADELARLD
AAYRHGG
NT seq 924 nt   +upstreamnt  +downstreamnt
gtgtgccacactccccggatgacctcggaaacgatcaccgcggaggccgcgggcacctgg
aaactcggcgacctgtccgtcaaccgcgtcggcttcggcgcgatgcggctgacgggcagt
gccgccttccacctcggcacaccaagtgaccgcgaacggtcggtcacggtgctgcggcgg
gcgctcgaactcggcgtcaaccacatcgacacggccgccttctacttctcctcgctgcgc
tccgcgaacgagttgatcaacagtgcgctggcgccgtacccggacgacctggtgatcgtc
acgaaggtcggcccgtaccgggactacacgggggagtggggcaccgcggcccgccccgac
caactgcgcggccatgtcgaggagaacctgcgccagctcggccgcgaccacctcgacgtg
gtgaacctccggcgtatgcggcaggactcgatcgccgagcacttcggggcgctcgccgaa
ctgcgcgaagcaggtctgatccggcacctcggcatctcctgcgtggaaccccggcacctc
gccgaggcgcaggcgatcgcgccggtggtgtgcgtgcagaaccagtacgggctccactcg
ccggatgccggggccgacacgatgctgcggatgtgcggcgaacagggcatcgcgttcgtg
ccgttcttcgcgatcgccggggagggcggtgcgcagggctccagcggcagcgaggacgac
gagatccgcgccgtcgcgcgggcgcacgaggccacgcccgcgcaggtgcggctggcgtgg
accctccagcagggtccgcacgtgctggccatccccggcaccggcaacccggaccacctt
gcggcgaacgtggccgcgggcgccatcaggctcacggccgacgagctggcgcgccttgac
gccgcgtaccggcacgggggatga

DBGET integrated database retrieval system