KEGG   Streptomyces avermitilis: SAVERM_1187
Entry
SAVERM_1187       CDS       T00126                                 

Gene name
aldH
Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00053  Ascorbate and aldarate metabolism
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma00340  Histidine metabolism
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00561  Glycerolipid metabolism
sma00620  Pyruvate metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00903  Limonene and pinene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1187 (aldH)
   00053 Ascorbate and aldarate metabolism
    SAVERM_1187 (aldH)
   00620 Pyruvate metabolism
    SAVERM_1187 (aldH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1187 (aldH)
   00561 Glycerolipid metabolism
    SAVERM_1187 (aldH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1187 (aldH)
   00310 Lysine degradation
    SAVERM_1187 (aldH)
   00330 Arginine and proline metabolism
    SAVERM_1187 (aldH)
   00340 Histidine metabolism
    SAVERM_1187 (aldH)
   00380 Tryptophan metabolism
    SAVERM_1187 (aldH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1187 (aldH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_1187 (aldH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_1187 (aldH)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAVERM_1187 (aldH)
SSDB
Motif
Pfam: Aldedh LuxC Rnk_N LmeA
Other DBs
NCBI-ProteinID: BAC68897
NITE: SAV1187
UniProt: Q82NV4
Position
complement(1477301..1478626)
AA seq 441 aa
MNDRTPEQPADTVARLRATFRTGRTKPVEWRTDQLDRLREMLTTHGADLAAALHADLGKS
STEAYRTEIDFTVREIDHTLSHLGTWLRPESAPVPPHLGDDATAWTQYDPLGVVLVIAPW
NYPAQLLLTPMIGALAAGNAVVVKPSELAPATSAVLARLLPQYLDTDAVAVVEGGIPETT
ALLAERFDHIFYTGNGVVGRIVMRAAAEHLTPVTLELGGKSPVFVDRDADLAVVADRLAR
GKFLNAGQTCVAPDYVLTDPETGRALETELARAVSSLYGPEPETSGEYGRIVNERHFDRL
SGLLDSGRVVTGGGSDRTAKYIAPTVLADVDPESPVMREEIFGPILPIVTVPGLDEAIDF
INDRDKPLALYVFTASGTTRQRIAAETSSGGLGYGLPLAHLTVSDLPFGGVGESGMGNYH
GRYSIETFSHRKAVLEKPLSV
NT seq 1326 nt   +upstreamnt  +downstreamnt
gtgaacgaccgcacccccgagcagcccgccgacaccgtggcccggctgcgcgccactttc
cgcaccggccgtaccaagcccgtcgagtggcgcacggaccagctggaccgactgcgcgag
atgctcacgacacatggcgcggacctcgccgccgccctccacgcggacctgggcaagagc
agcaccgaggcctaccgcacggagatcgacttcaccgtccgcgagatcgaccacacgctt
tcccacctcggcacctggctgcgccccgagtccgccccggtcccgccgcacctcggtgac
gacgcgacggcctggacgcagtacgaccccctcggcgtcgtgctggtcatcgctccctgg
aactatccggcgcagcttctgctcacgccgatgatcggcgcgctggccgcgggcaacgcg
gtcgtcgtcaagcccagcgagctggcccccgccacctcggccgtcctcgcgcgtctgctg
ccgcagtacctcgacaccgatgcggtcgccgtcgtcgagggcggcatcccggagaccacc
gccctgctcgccgagcgcttcgaccacatcttctacaccggcaacggcgtggtcggccgc
atcgtgatgcgcgccgccgccgagcacctgaccccggtcacactcgaactgggcggcaag
tccccggtgttcgtcgaccgcgacgcggacctcgccgtcgtcgccgaccgtctcgcgcgc
ggcaagttcctcaacgcgggccagacctgcgtcgcccccgactacgtcctgaccgacccg
gagaccggccgcgccctggagacggagctcgcccgcgccgtctcgtcgctctacggcccc
gaaccggagacctccggcgagtacgggcgcatcgtcaacgaacgtcacttcgaccggctc
agtggcctgctcgactccggccgggtcgtcaccggcggcggcagcgaccgtacggccaag
tacatcgcgccgaccgtcctcgccgacgtcgaccccgagtcgcccgtgatgcgggaggag
atcttcggcccgatcctgccgatcgtcacggtgccgggcctggacgaggcgatcgacttc
atcaacgaccgcgacaagcccctcgccctgtacgtcttcaccgcgtccggcacgacccgg
cagcgcatcgccgccgagacgtcctccggagggctcggctacggcctgccgctcgcccat
ctcaccgtctccgacctgccgttcggcggcgtgggggagagcggtatgggcaactaccac
ggccgctactcgatcgagacgttcagtcaccgcaaggcggtgctggagaagccgctgagc
gtctga

KEGG   Streptomyces avermitilis: SAVERM_2579
Entry
SAVERM_2579       CDS       T00126                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00053  Ascorbate and aldarate metabolism
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma00340  Histidine metabolism
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00561  Glycerolipid metabolism
sma00620  Pyruvate metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00903  Limonene and pinene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_2579
   00053 Ascorbate and aldarate metabolism
    SAVERM_2579
   00620 Pyruvate metabolism
    SAVERM_2579
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_2579
   00561 Glycerolipid metabolism
    SAVERM_2579
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2579
   00310 Lysine degradation
    SAVERM_2579
   00330 Arginine and proline metabolism
    SAVERM_2579
   00340 Histidine metabolism
    SAVERM_2579
   00380 Tryptophan metabolism
    SAVERM_2579
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_2579
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_2579
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_2579
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAVERM_2579
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BAC70290
NITE: SAV2579
UniProt: Q82K25
Position
complement(3169298..3170743)
AA seq 481 aa
MAATHAFWLAGRQATGETTFDVTSPWDGRLVGKVSVPTEAQTEEAVAAAYAVRDEFAATP
AHVRAAALDHVSKRLVERTEEIAQLISAENGKPIKWARGEVGRAVSVFRFAAEEARRFNG
GEAQRLDTDAGGQGRLALTRRFPKGVVLGIAPFNFPLNLCAHKVAPAIAAGAPIILKPAP
ATPLSGLVIGDLLAETDLPAGSWSILPVSNDRMPALVQDERLPVISFTGSEKVGYAIMDS
VPRKHCTLELGGNGAAVVLADYASDADLDWAAGRIATFSNYQGGQSCISVQRVIADASVY
ERLLPRVVAAVEAQVTGDPSDDATEVGPLVSEDAAKRVESWVDEAAQAGARVLTGGKREG
ASYAPTVLVDVPADVTLSCEEVFGPVLTVQKVEGEAAAFAAVNESKYGLQAGVFTHDLQA
AFRAHRALEVGGVVIGDVPSYRADQMPYGGVKQSGVGREGVKFAMDDYTYERVLVLTGLA
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
gtggcagccacccacgccttctggctcgccggccgccaggccaccggtgagaccaccttc
gacgtcacctctccgtgggacgggcggctcgtcggcaaggtctccgtgcccaccgaggcg
cagaccgaggaggccgtggccgccgcgtacgccgtgcgcgacgagttcgccgccaccccg
gcgcatgtgcgtgccgccgccctcgaccacgtcagcaagcggctcgtcgagcgcaccgag
gagatcgcccagctgatctccgccgagaacggcaagccgatcaagtgggcgcgcggggag
gtcgggcgtgccgtctccgtgttccggttcgcggccgaggaggcccggcggttcaacggt
ggcgaggctcagcggctcgacaccgacgcgggcggccagggccggctggcgctgacccgg
cggttcccgaagggtgtcgtgctcggcatcgcgccgttcaacttcccgctcaacctgtgt
gcccacaaggtcgcccccgcgatcgcggccggcgcgccgatcatcctgaagcccgccccc
gcgacgccgctgtcgggtctcgtcatcggtgacctgctcgccgagaccgacctgcccgcc
ggttcgtggagcatcctgcccgtgtcgaacgaccggatgcccgctctcgtccaggacgag
cggctgcccgtcatctccttcaccgggtccgagaaggtcggttacgcgatcatggactcg
gtgccgcgcaagcactgcacgctggagctcggcggcaacggcgcggcggtcgtgctcgcc
gactacgcgagcgacgcggacctggactgggccgccggccgtatcgccaccttctccaac
taccagggcgggcagtcctgcatctccgtgcagcgggtgatcgcggacgcgtcggtgtac
gagcggctgctgccccgggtcgtcgccgccgtcgaggcccaggtcaccggtgacccgtcg
gacgacgcgaccgaagtcggcccgctggtcagcgaggacgccgccaagcgcgtcgagtcg
tgggtggacgaggccgcgcaggccggtgcccgggtgctgacgggcggcaagcgcgagggt
gcctcgtacgcgccgaccgtgctcgtcgatgtgccggccgacgtgacgctctcgtgcgag
gaggtcttcgggcccgtcctcaccgtgcagaaggtggagggggaggcggccgccttcgcc
gccgtcaacgagtcgaagtacgggctccaggccggtgtgttcacgcacgacctccaggcc
gccttccgggcccaccgtgccctggaggtcggcggtgtcgtcatcggcgacgtgccgtcc
taccgcgccgaccagatgccctacggcggcgtcaagcagtcaggcgtcggccgcgagggc
gtgaagttcgcgatggacgactacacctacgagcgggtgctggtcctgacgggcctcgcc
ctctga

KEGG   Streptomyces avermitilis: SAVERM_3347
Entry
SAVERM_3347       CDS       T00126                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00053  Ascorbate and aldarate metabolism
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma00340  Histidine metabolism
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00561  Glycerolipid metabolism
sma00620  Pyruvate metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00903  Limonene and pinene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3347
   00053 Ascorbate and aldarate metabolism
    SAVERM_3347
   00620 Pyruvate metabolism
    SAVERM_3347
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_3347
   00561 Glycerolipid metabolism
    SAVERM_3347
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_3347
   00310 Lysine degradation
    SAVERM_3347
   00330 Arginine and proline metabolism
    SAVERM_3347
   00340 Histidine metabolism
    SAVERM_3347
   00380 Tryptophan metabolism
    SAVERM_3347
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_3347
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_3347
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_3347
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAVERM_3347
SSDB
Motif
Pfam: Aldedh OmdA DUF1487
Other DBs
NCBI-ProteinID: BAC71058
NITE: SAV3347
UniProt: Q82I11
Position
4163729..4165165
AA seq 478 aa
MASAFEYAPAPESRSVVDIAPSYGLFIDGEFTEAADGKVFKTVSPSTEEVLSEIAQAGEA
DVDRAVKAARKAFEKWSALPGSERAKYLFRIARIIQERSRELAVLETLDNGKPIKETRDA
DLPLVAAHFFYYAGWADKLDHAGFGANPRPLGVAGQVIPWNFPLLMLAWKIAPALATGNT
VVLKPAETTPLSALFFADICRQAGLPKGVVNIIPGYGDAGAALVEHPDVNKVAFTGSTAV
GKAIARQVAGTEKKVTLELGGKGANIVFDDAPIDQAVEGIVTGIFFNQGQVCCAGSRLLV
QESVQDELLDSLKRRLSTLRLGDPLDKNTDIGAINSAEQLSRITSLVDQGEAEGAERWSP
ACELPSSGYWFAPTLFTNVTQAHTIARDEIFGPVLSVLSFRTPDEAVAKANNSQYGLSAG
IWTEKGSRILAVASKLRAGVIWANTFNKFDPTSPFGGYKESGFGREGGRHGLEAYLDV
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcttccgcattcgaatacgcaccggcgcccgagtcccgctccgtcgtcgacatcgcc
ccgtcgtacgggctcttcatcgacggcgagttcaccgaggccgccgacggcaaggtcttc
aagacggtcagcccgagcaccgaagaggtcctctccgagatcgcccaggcgggcgaggcg
gacgtcgaccgggccgtgaaggccgcccgcaaggccttcgagaagtggtcggcgctgccc
ggctccgagcgcgccaagtacctgttccgtatcgcccggatcatccaggagcgctcccgc
gagctcgccgtcctggagaccctggacaacggaaagcccatcaaggagacgagggacgcc
gacctccccctggtcgccgcgcacttcttctactacgcgggctgggccgacaagctcgac
cacgccgggttcggcgcgaacccgcgcccgctgggcgtggccggccaggtcatcccctgg
aacttccccctcctgatgctggcgtggaagatcgccccggcgctcgcgaccggcaacacg
gtcgtcctgaagcccgccgagaccacgcccctgtcggcgttgttcttcgcggacatctgc
cgccaggcgggccttcccaagggcgtcgtcaacatcattcccgggtacggcgacgcgggc
gccgccctcgtcgagcacccggacgtcaacaaggtcgccttcaccggctccacggccgtc
ggcaaggccatcgcgcgccaggtcgcgggcacggagaagaaggtcaccctcgaactgggc
ggcaagggcgccaacatcgtcttcgacgacgcccccatcgaccaggccgtcgagggcatc
gtcaccggcatcttcttcaaccagggccaggtctgctgcgccgggtcccgtctcctcgta
caggagtcggtccaggacgagctgctcgactccctgaagcgccgcctgtccaccctccgc
ctcggcgacccgctggacaagaacacggacatcggcgcgatcaactcggccgagcagctg
tcccgtatcacctcactcgtcgaccagggcgaggcggagggcgccgagcgctggtccccg
gcctgcgaactcccgtcgtccggctactggttcgcgccgacgctgttcaccaacgtcacc
caggcgcacaccatcgcccgcgacgagatcttcggcccggtgctctccgtcctcagcttc
cgcaccccggacgaggccgtcgccaaggccaacaactcccagtacggcctctcggcgggc
atctggaccgagaagggctcccggatcctggccgtcgcgagcaagctccgcgcgggcgtc
atctgggccaacacgttcaacaagttcgacccgacctcgccgttcggcggttacaaggag
tcgggcttcggccgcgagggcggccgtcacggcctggaggcgtacctcgatgtctga

KEGG   Streptomyces avermitilis: SAVERM_4650
Entry
SAVERM_4650       CDS       T00126                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00053  Ascorbate and aldarate metabolism
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma00340  Histidine metabolism
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00561  Glycerolipid metabolism
sma00620  Pyruvate metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00903  Limonene and pinene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4650
   00053 Ascorbate and aldarate metabolism
    SAVERM_4650
   00620 Pyruvate metabolism
    SAVERM_4650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_4650
   00561 Glycerolipid metabolism
    SAVERM_4650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_4650
   00310 Lysine degradation
    SAVERM_4650
   00330 Arginine and proline metabolism
    SAVERM_4650
   00340 Histidine metabolism
    SAVERM_4650
   00380 Tryptophan metabolism
    SAVERM_4650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_4650
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_4650
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_4650
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAVERM_4650
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: BAC72362
NITE: SAV4650
UniProt: Q82EG5
Position
5673611..5675071
AA seq 486 aa
MSSYFTDLAQQYIGGEWRPGTGSWDIIDFNPYDGEKLASITIATVDEVDEAYRAAAAAQK
EWAATNAYARRAVFQRALRLIEDREAEITEAIIAELGGTHLKAGFELHLAKQFLLESINL
ALRPEGRIIPSPVDGKENRLYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNGVVLKPH
QNTPIVGGSLIAKIFEDAGLPGGLLNVVITDIAEIGDAFLEHPVPKVISFTGSDKVGRHV
ATVCAAQFKRSVLELGGNSALVVLEDADIDYAVDAAVFSRYVHQGQVCMAANRVLVDRSI
EAEFTEKFVAKVKTLKSGDPRDPQTIIGPVINSSQADAISGAVDQAIADGAIALVHGTTT
DNLVEPSVLTGLAADAPILQEEIFGPVALLIPFEGEEEAVRIVNDTPYGLSGAVHTADVE
RGVAFAKQIDTGMFHVNDGTVHDEPLVAFGGEKSSGIGRLNGEATVESFTTQKWISVQHG
RSFFPF
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcgtcctacttcaccgatctggctcagcagtacatcggtggtgagtggcgcccgggc
acagggtcctgggacatcatcgacttcaacccgtacgacggtgagaagctcgcgtcgatc
accatagccacggtcgacgaggtggacgaggcctaccgggcggccgccgcggcccagaag
gaatgggcggcgaccaacgcgtatgcccgccgtgccgtgttccagcgggccctgcgcctc
atcgaggaccgcgaggccgagataaccgaggccatcatcgccgagctcggcggcacgcat
ctgaaggccggcttcgagctgcacctcgccaagcagttcctcctggagtcgatcaacctg
gcgctgcgccccgagggacggatcatcccctcgccggtcgacggcaaggagaaccgcctc
taccgcgtgcccgtcggcgtcgtcggcgtgatcagcccgttcaacttccccttcctcctg
tcgctgaagtccgtcgccccggccctggccctcggcaacggcgtggtcctcaagccgcac
cagaacacaccgatcgtcggcggctcgctgatcgcgaagatcttcgaggacgcgggtctg
ccgggcggcctcctgaacgtcgtgatcaccgacatcgcggagatcggcgacgcctttctc
gagcacccggtcccgaaggtcatctccttcaccggctccgacaaggttggccgccacgtg
gccaccgtctgcgccgcccagttcaagcgctcggtgctcgaactcggcggcaacagcgcc
ctggtggtcctggaggacgcggacatcgactacgccgtggacgccgcggtcttcagccgg
tacgtgcaccaggggcaggtctgcatggccgcgaaccgcgttctcgtggaccgctcgatc
gaggcggagttcaccgagaagttcgtcgccaaggtgaagacgctgaagtccggtgacccg
cgcgacccgcagacgatcatcggcccggtcatcaactcctcgcaggcggacgcgatctcg
ggcgccgtcgaccaggcgatcgcggacggcgccatcgcgctggtgcacggcaccaccacg
gacaacctcgtggagccgtccgtcctgaccggcctggccgccgacgcgcccatcctccag
gaggagatcttcggcccggtcgcgctcctcatccccttcgagggcgaggaggaggcggtc
cgtatcgtcaacgacaccccgtacggcctgagcggcgccgtccacacggccgacgtcgag
cgcggtgtcgccttcgccaagcagatcgacaccggcatgttccacgtcaacgacggcacc
gtccacgacgagccgctggtcgccttcggcggcgagaagtcctcgggcatcggccggctg
aacggcgaggcgacggtcgagtcgttcaccacgcagaagtggatctcggtgcagcacggg
cggagcttcttcccgttctga

KEGG   Streptomyces avermitilis: SAVERM_5852
Entry
SAVERM_5852       CDS       T00126                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00053  Ascorbate and aldarate metabolism
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma00340  Histidine metabolism
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00561  Glycerolipid metabolism
sma00620  Pyruvate metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00903  Limonene and pinene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5852
   00053 Ascorbate and aldarate metabolism
    SAVERM_5852
   00620 Pyruvate metabolism
    SAVERM_5852
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_5852
   00561 Glycerolipid metabolism
    SAVERM_5852
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5852
   00310 Lysine degradation
    SAVERM_5852
   00330 Arginine and proline metabolism
    SAVERM_5852
   00340 Histidine metabolism
    SAVERM_5852
   00380 Tryptophan metabolism
    SAVERM_5852
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_5852
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_5852
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_5852
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAVERM_5852
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: BAC73564
NITE: SAV5852
UniProt: Q82B53
Position
7060741..7062249
AA seq 502 aa
MRPGRQSAMTELVEHGQLFIGGVLADPLGKDVIEVISPHTEEVIGRVPHASTADVDRAVA
VARKAFDEGPWPRATLDERIEVVTRIKDAIAVRHEEIARVISSENGSPYSWSVLAQALGA
MMVWDAAITVARNFTYEETRDGVLGKIVVRREPVGVVAAVVPWNVPQFVAAAKLAPALLT
GCTVVLKPSPESPLDAYLLGEIAREAGLPEGVLSILPADREVSEYLVGHPGIDKVSFTGS
VAAGRRVMEVASRNLTRVTLELGGKSAAVVLPDADITTSVPGIVSAAWMNNGQACVAQTR
ILVPRSRYDEFADAFAAAASALVVGDPLDPATQVGPLVARRQQRRNLDYIRIGQEEGAKI
LTGGGRPPGLDRGWYVEPTLFGDVDNSMRIAREEIFGPVICLLPYGDETEAVKIANDSDY
GLSGSVWTADVEHGIDVARRVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEFL
EHKMIHLPAGYEAPTGVEGAGA
NT seq 1509 nt   +upstreamnt  +downstreamnt
gtgcgtcccgggaggcagtcggccatgaccgagctcgtggaacacggacagctgttcatc
ggcggggtgttggcggacccgctgggcaaggacgtcatcgaggtgatctccccgcacacc
gaggaggtcatcggacgggtgccgcacgcctccacggcggacgtggaccgcgcggtcgcc
gtcgcgcgcaaggcgttcgacgagggcccctggccgcgcgcgaccctcgacgagcgcatc
gaggtcgtcacccggatcaaggacgccatcgcggtacggcacgaggagatcgcccgggtc
atctcctccgagaacggttcgccgtactcctggagcgtcctcgcgcaggccctcggcgcg
atgatggtgtgggacgcggcgatcacggtcgcgcggaacttcacctacgaggagacccgc
gacggagtcctcgggaagatcgtggtgcggcgcgagccggtgggcgtggtcgcggccgtg
gtcccgtggaacgtgccgcagttcgtcgccgccgccaagctcgcccccgcgctgctgacc
ggctgcacggtcgtactgaagccgtcgcccgaatcgcccctggacgcctatctgctgggc
gagatcgcccgggaggccgggctgccggaaggcgtgctgtcgatcctgccggcggaccgc
gaggtgagcgagtacctggtcgggcaccccgggatcgacaaggtctccttcacgggatcg
gtggccgcgggcaggcgcgtgatggaggtcgcctcccgcaatctcacccgggtgaccctg
gagctgggcggcaagtcggcggcggtggtcctgccggacgcggacatcacgacctcggtg
ccggggatcgtctccgcggcctggatgaacaacgggcaggcctgcgtggcccagacgcgc
atcctcgttccgcgctcgcgctacgacgagttcgcggacgcgttcgcggcggcggcgagc
gccctggtggtcggtgacccgctggacccggcgacccaggtcggcccgctggtggcgagg
cggcagcagcggcgcaacctcgactacatccgcatcggccaggaggagggcgccaagatc
ctgacgggcggcgggcgtccaccgggactcgaccgcggctggtacgtggagccgaccctc
ttcggcgacgtcgacaactccatgcggatcgcgcgggaggagatcttcgggccggtcatc
tgcctgctgccctacggcgacgagaccgaggccgtgaagatcgccaacgactccgactac
gggctgagcggcagtgtctggacggccgacgtggagcacggcatcgacgtcgcacgccgg
gtccgtacgggcacgtactccgtgaacaccttcagcctcgacatgctcggcccgttcggc
ggctacaagaactcgggtctcgggcgggagttcgggcccgaggggtacggcgagttcctg
gagcacaagatgatccacctgccggccgggtacgaggctcccacgggcgtggagggggcc
ggggcctga

KEGG   Streptomyces avermitilis: SAVERM_6595
Entry
SAVERM_6595       CDS       T00126                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00053  Ascorbate and aldarate metabolism
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma00340  Histidine metabolism
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00561  Glycerolipid metabolism
sma00620  Pyruvate metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00903  Limonene and pinene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6595
   00053 Ascorbate and aldarate metabolism
    SAVERM_6595
   00620 Pyruvate metabolism
    SAVERM_6595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_6595
   00561 Glycerolipid metabolism
    SAVERM_6595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_6595
   00310 Lysine degradation
    SAVERM_6595
   00330 Arginine and proline metabolism
    SAVERM_6595
   00340 Histidine metabolism
    SAVERM_6595
   00380 Tryptophan metabolism
    SAVERM_6595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_6595
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_6595
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_6595
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAVERM_6595
SSDB
Motif
Pfam: Aldedh OmdA
Other DBs
NCBI-ProteinID: BAC74306
NITE: SAV6595
UniProt: Q828R7
Position
7893453..7894841
AA seq 462 aa
MKAQDGMYIDGAWRPAAGPDMIEVVNPADEQVIGRVPAGTPEDVDAAVRAARAALTAWAA
TPPAERAARISALRDVLVARQDEIAETVTAELGSPLSFSQSVQVGLPILVAGSYAELAAT
YAFEERVGNSTVHHEPVGVVGAITPWNYPLHQIVAKVAPALAAGCTIVLKPAEDTPLTAQ
LFAEAVHEAGVPAGVFNLVTGLGPVAGQALAEHEDVDLVSFTGSTAVGRQIGATAGAAVK
RVALELGGKSANVILPSADLAKAVNVGVANVMANSGQTCSAWTRMLVHAERYEEAVELAA
AAAVKYADRIGPLVNAKQRARVRGYIDKGVAEGARLVAGGPESTEPQGYFVSPTVFADVT
PEMTIAKEEIFGPVLSVIRYEDEEEALRIANGTVYGLAGAVWAGDEAEAVAFARRLDTGQ
VDINGGRFNPLAPFGGYKQSGVGRELGAHGLAEYLQTKSLQF
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaaggcacaggacggcatgtacatcgacggcgcctggcggcccgccgcggggccggac
atgatcgaggtcgtgaacccggccgacgagcaggtgatcggccgggtgccggcgggcact
cccgaggacgtggacgcggccgtacgtgccgcgcgtgccgccctgaccgcctgggccgcg
accccgcccgccgagcgggccgcgcggatctccgccctccgggacgtcctggtggcccgc
caggacgagatcgccgagaccgtcacggccgaactcggctcaccgctgtcgttctcgcag
agcgtgcaggtgggcctgccgatcctggtcgcgggttcgtacgccgaactcgcggcgacg
tacgccttcgaggagagggtgggcaactcgaccgtccaccacgagccggtcggcgtggtc
ggcgccatcaccccctggaactaccccctgcaccagatcgtcgccaaggtcgccccggca
ctcgcggcgggctgcacgatcgtactgaagcccgccgaggacaccccgctgaccgcccag
ctcttcgcggaggcggtccacgaggccggtgtcccggcgggtgtgttcaacctcgtcacc
ggcctcggcccggtcgcgggacaggcgctcgccgagcacgaggacgtcgacctggtctcg
ttcaccggctcgacggcggtcggcaggcagatcggtgccacggccggtgcggccgtcaag
cgggtcgccctcgaactcggcggcaagtccgccaacgtcatcctgccgagcgccgacctc
gccaaggcggtgaacgtgggcgtcgccaacgtgatggccaactccggccagacgtgcagc
gcctggacgcgcatgctggtgcacgcggagcggtacgaggaggcggtcgagctggccgcg
gccgccgcggtgaagtacgcggaccgcatcggcccgctggtgaacgccaagcagcgcgcc
cgggtgcgcggttacatcgacaagggtgtcgccgagggcgcacggctcgtcgcgggcggc
cccgaatccaccgagccgcagggctacttcgtcagccccaccgtcttcgccgacgtcacg
cccgagatgacgatcgcgaaggaggagatcttcggcccggtcctctcggtcatccggtac
gaggacgaggaggaggccctgcggatcgccaacggcacggtgtacggcctcgccggcgcc
gtctgggcgggcgacgaggcggaggcggtcgccttcgcccgcaggctcgacaccgggcag
gtcgacatcaacggcggccgcttcaacccccttgcgcccttcgggggttacaagcagtcg
ggcgtgggccgtgagctcggcgcgcacggcctcgccgagtacctccagaccaagtccctc
cagttctag

DBGET integrated database retrieval system