KEGG   Streptomyces avermitilis: SAVERM_1242
Entry
SAVERM_1242       CDS       T00126                                 

Definition
(GenBank) putative nonspecific lipid-transfer protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_1242
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_1242
   00640 Propanoate metabolism
    SAVERM_1242
   00650 Butanoate metabolism
    SAVERM_1242
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1242
   00072 Synthesis and degradation of ketone bodies
    SAVERM_1242
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1242
   00310 Lysine degradation
    SAVERM_1242
   00380 Tryptophan metabolism
    SAVERM_1242
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_1242
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1242
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_1242
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_1242
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVERM_1242
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_1242
SSDB
Motif
Pfam: Thiolase_N TsaD
Other DBs
NCBI-ProteinID: BAC68952
NITE: SAV1242
UniProt: Q82NQ0
Position
complement(1540794..1541960)
AA seq 388 aa
MSKEPVAVVGIGQTRHVAARRDVSIAGLVREAAQRALLDAELTWADIDAVVIGKAPDFFE
GVMMPELYLADALGAVGKPMLRVHTAGSVGGSTALVATNLIAGRVHGTVLTLAYEKQSES
NAMWGLSLPIPFQQPLLAGAGGFFAPHVRAYMRRSGAPDTVGSLVAYKDRRNALKNPYAH
LHEHDITLEKVQASPMLWDPIRYSETCPSSDGACAMILTDRAGAARSPRPPAWLHGGAMR
SEPTLFAGKDAVSPQAGKDCAADVYRQAGITDPRREIDAVEMYVPFSWYEPMWLENLGFA
DEGEGWKLTESGVTELDGDLPVNMSGGVLSTNPIGASGMIRFAEAALQVRGQAGEHQVEG
ARRVLGHAYGGGSQFFSMWLVGAEPPVL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgagcaaggagcccgtggccgtcgtgggcatcggccagaccaggcacgtggccgcccgg
cgggacgtctcgatcgcgggccttgtccgagaggcggcccaacgggcccttttggacgcc
gagttgacatgggccgacatcgacgccgtggtcatcggcaaggcgcccgacttcttcgag
ggcgtcatgatgcccgagctgtacctcgccgacgcgctcggcgcggtgggcaagcccatg
ctgcgggtgcacacggccggctcggtcggcggctccaccgccctcgtcgccacgaacctg
atcgcgggccgcgtccacggcaccgtcctgaccctggcctacgagaagcagtccgagtcc
aacgccatgtggggcctgtccctgccgatccccttccagcagcccctgctcgccggggcg
ggcggcttcttcgcaccgcacgtacgcgcgtacatgcggcgcagcggcgcccccgacacc
gtgggctccctggtcgcgtacaaggaccgccgcaacgcactgaagaatccgtacgcgcac
ctccatgaacacgacatcaccctggagaaggtccaggcgtccccgatgctgtgggacccg
atccgctactcggagacctgcccgtcctccgacggcgcctgcgcgatgatcctcaccgac
cgtgcgggcgcggcccgttcgccgcggccgcccgcgtggctgcacggcggcgcgatgcgc
agcgagccgaccctcttcgccggcaaggacgcggtctcaccgcaggccggcaaggactgc
gcggccgacgtctaccggcaggcggggatcacggacccgcgccgggagatcgacgccgtg
gagatgtacgtgccgttctcctggtacgagcccatgtggctggagaacctcggcttcgcc
gacgagggcgagggctggaagctcaccgagtccggggtgacggaactcgacggggacctg
cccgtcaacatgtcgggcggggtcctctccaccaatccgatcggcgcctccggcatgatc
cgcttcgcggaagcagcgcttcaggtgcgcggccaggccggagaacaccaggtggaaggg
gctcgcagggtgctcgggcacgcgtacggcggcgggtcgcagttcttctcgatgtggctg
gtcggggcggagcccccggtcttgtga

KEGG   Streptomyces avermitilis: SAVERM_1384
Entry
SAVERM_1384       CDS       T00126                                 

Gene name
fadA5
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_1384 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_1384 (fadA5)
   00640 Propanoate metabolism
    SAVERM_1384 (fadA5)
   00650 Butanoate metabolism
    SAVERM_1384 (fadA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1384 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    SAVERM_1384 (fadA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1384 (fadA5)
   00310 Lysine degradation
    SAVERM_1384 (fadA5)
   00380 Tryptophan metabolism
    SAVERM_1384 (fadA5)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_1384 (fadA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1384 (fadA5)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_1384 (fadA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_1384 (fadA5)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVERM_1384 (fadA5)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_1384 (fadA5)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SHS2_FTSA
Other DBs
NCBI-ProteinID: BAC69094
NITE: SAV1384
UniProt: Q82NB9
Position
complement(1702011..1703210)
AA seq 399 aa
MREAVIVSTARTPIGKAYRGAFNDTQAQELAAHALSHAVRRAGLEGGEVEDVIFGCAVQQ
GSSGGNVARQAALRAGLPDTVSGMTVDRQCSSGLMAIATAAKQIVTDGMQVAVGGGVESI
SLVQNDRMNTHRMADPWLVEHKPSIYMPMLQTAEIVAERYGVSRERQDEFALVSQQRTAA
AQEAGRFDREIVALGSVKKVLDKQTGEVRDEEVTLTRDEGNRASTTLEGLAGLAPVLPDG
QVSAHSSVTAGNSSQLSDGASASVLMESKEAERRGLEPLGVYRGMTVAGCGPDEMGIGPV
FAIPKLLKQHDLTMDDIGLWELNEAFASQALYCRDELHIDPERFNVDGGAISVGHPYGMT
GARLVGHALIEGKRRGVRYVVVSMCVGGGMGAAGLFEVV
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgagggaagcagtcatcgtttcgacggcacggacgccgatcggaaaggcctaccggggc
gcgttcaacgacacccaggcgcaggaacttgccgcccatgccctttcgcacgcggtgcgg
cgcgccgggctcgagggaggtgaggtcgaggatgtgatcttcggctgcgccgtgcagcag
ggatcctccggtggcaacgtggcgcgtcaggccgctctccgtgccggacttccggacacc
gtgtcgggcatgacggtcgaccggcagtgctcgtcgggcctgatggccattgcgacggcc
gccaagcagattgtcacggacggcatgcaggtcgctgtcggcggcggtgtcgagtcgatc
tccttggtgcagaacgaccgcatgaacacccaccgcatggcggatccctggctggtcgag
cacaagccgagtatctacatgccgatgttgcagacggcggagatcgtcgccgaacgttac
ggcgtgagccgggaacgccaggacgagttcgcgctggtgtcacagcagcgcaccgcggcg
gcgcaggaggccggccggttcgaccgcgagatcgtggcgctcggcagcgtcaagaaggtc
ctcgacaagcagaccggcgaggtgcgggacgaggaggtcaccctgacccgggacgagggc
aaccgcgcgtcgacgacgctcgaaggtctggccgggctggcgccggtgcttccggacggt
caggtgagcgcgcattccagcgtgacggcgggcaactcctcgcagttgtcggacggggct
tcggcgtcggtactgatggagtcgaaggaggccgagcgccgcggactggaaccgctgggc
gtctaccggggtatgaccgttgccggttgtgggccggacgagatgggcatcggtccggtg
ttcgccattccgaaactgctgaagcagcacgacctcaccatggacgacatcggcctgtgg
gaactcaacgaggcgttcgcttcccaggcgttgtactgccgtgacgaactgcatatcgac
ccggagcggttcaacgtcgacggcggcgcgatctcggtcggtcatccgtacggaatgacc
ggtgcccggctggtggggcatgccctcatcgagggcaagcgccgaggtgtccggtatgtg
gtggtctcgatgtgcgtcggcggcggcatgggcgcggccggactgttcgaggtcgtctga

KEGG   Streptomyces avermitilis: SAVERM_1681
Entry
SAVERM_1681       CDS       T00126                                 

Gene name
fadA4
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_1681 (fadA4)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_1681 (fadA4)
   00640 Propanoate metabolism
    SAVERM_1681 (fadA4)
   00650 Butanoate metabolism
    SAVERM_1681 (fadA4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1681 (fadA4)
   00072 Synthesis and degradation of ketone bodies
    SAVERM_1681 (fadA4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1681 (fadA4)
   00310 Lysine degradation
    SAVERM_1681 (fadA4)
   00380 Tryptophan metabolism
    SAVERM_1681 (fadA4)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_1681 (fadA4)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1681 (fadA4)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_1681 (fadA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_1681 (fadA4)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVERM_1681 (fadA4)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_1681 (fadA4)
SSDB
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C DUF5423
Other DBs
NCBI-ProteinID: BAC69392
NITE: SAV1681
UniProt: Q82MH9
Position
complement(2058688..2059902)
AA seq 404 aa
MSTEAYVYDAIRTPRGRGKASGALHGTKPIDLVVGLIHEIRDRFPGLDPAAIDDIVLGVV
GPVGDQGSDIARIAAIAAGLPDTVAGVQENRFCASGLEAVNLAAVKVRSGWEDLVLAGGV
ESMSRVPMASDGGAWFADPMTNMATNFVPQGIGADLIATIEGFTRRDVDEYAALSQERAA
AAWKDGRFEKSVVPVKDRSGLVVLDHDEHLRPGTTADSLAKLKPSFADIGDLGGFDAVAL
QKYHWVEQIDHVHHAGNSSGIVDGASLVAIGSKEVGERYGLRPRARIVSAAVSGSEPTIM
LTGPAPATRKALAKAGLSIDDIDLVEINEAFAAVVLRFARDMGLSLDKVNVNGGAIALGH
PLGATGAMILGTLVDELERQDKRYGLATLCVGGGMGIATIVERV
NT seq 1215 nt   +upstreamnt  +downstreamnt
gtgagcaccgaagcgtacgtgtacgacgcgatccgcaccccgcgcgggcgtggcaaggcc
agcggggccctgcacggcacgaagcccatcgacctcgtggtgggactcatccacgagatc
cgcgaccgtttccccgggctggacccggccgcgatcgacgacatcgtgctcggtgtggtg
ggtcctgtcggcgaccagggctccgacatcgcccggatcgccgcgatcgcggccgggctg
cccgacacggtggccggcgtccaggagaaccgcttctgcgcgtccggcctggaggcggtc
aacctggccgccgtcaaggtccgttcgggctgggaggacctggtgctcgcgggcggcgtc
gagtcgatgtcccgggtgccgatggcttcggacggcggcgcctggttcgccgacccgatg
accaacatggccaccaacttcgtaccgcagggcatcggcgccgatctcatcgccacgatc
gagggcttcacccgccgggacgtcgacgagtacgcggcgctctcccaggagcgggccgcg
gccgcctggaaggacgggcgcttcgagaagtccgtcgtgcccgtgaaggaccgcagcggt
ctcgtcgttctcgaccacgacgagcacctgcggcccggcaccaccgccgactcgctcgcc
aagctgaagccgtcgttcgccgacatcggcgacctgggcggcttcgacgcggtcgccctc
cagaagtaccactgggtcgagcagatcgaccacgtccaccacgcgggcaactcgtccggc
atcgtggacggcgcctcgctggtcgccatcggctcgaaggaggtcggcgagcgctacggt
ctgcggccccgcgcccgcatcgtctccgccgccgtctccggctccgagcccaccatcatg
ctcacgggccccgcgcccgccacccgcaaggcgctcgccaaggcggggctgagcatcgac
gacatcgacctggtcgagatcaacgaggccttcgcggccgtagtcctgcgcttcgcgcgg
gacatgggcctgtccctggacaaggtcaacgtcaacggcggcgccatcgccctcgggcac
ccgctcggagccaccggcgcgatgatcctcggcaccctcgtcgacgaactggagcgccag
gacaagcgctacggcctggccacgctgtgcgtcggcggcggcatgggcatcgcgacgatc
gtcgagcgtgtctga

KEGG   Streptomyces avermitilis: SAVERM_2856
Entry
SAVERM_2856       CDS       T00126                                 

Gene name
fadA1
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_2856 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2856 (fadA1)
   00640 Propanoate metabolism
    SAVERM_2856 (fadA1)
   00650 Butanoate metabolism
    SAVERM_2856 (fadA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_2856 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    SAVERM_2856 (fadA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2856 (fadA1)
   00310 Lysine degradation
    SAVERM_2856 (fadA1)
   00380 Tryptophan metabolism
    SAVERM_2856 (fadA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_2856 (fadA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_2856 (fadA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_2856 (fadA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_2856 (fadA1)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVERM_2856 (fadA1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_2856 (fadA1)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Other DBs
NCBI-ProteinID: BAC70567
NITE: SAV2856
UniProt: Q82JA9
Position
complement(3498639..3499841)
AA seq 400 aa
MSGTNSTTSVIVAGARTPMGRLLGSLKSFSGADLGGFAIKSALDRAGIGGDQVQYVIMGQ
VLQAGAGQIPARQAAVKAGIPMSVPALTINKVCLSGLDAIALADQLIRAGEFDVVVAGGQ
ESMTNAPHLLPKSREGYKYGAVQMIDAMAYDGLTDAFENIAMGESTEKHNTRLGIGRADQ
DAVAALSHQRAAAAQKNGIFEAEITPVEIPQRRGEPVVFSQDEGIRGETTAESLGKLRPA
FTKDGTITAGSSSQISDGAAAVVVMSKAKAQELGLEWIAEIGAHGNVAGPDNSLQSQPSN
AIQHALKKEGLAVDDLDLIEINEAFAAVAVQSMKDLGVSTEKVNVNGGAIALGHPIGMSG
ARLVLHLALELKRRGGGVGAAALCGGGGQGDALIVRVPKV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtctggaacgaacagcacgacctcggtgatcgtcgcgggtgcacgcaccccgatgggc
cgtttgctcggctcgctgaagtccttctccggagccgacctcggcggcttcgcgatcaag
tccgccctcgaccgtgcggggatcggcggcgaccaggtgcagtacgtgatcatgggccag
gtgctgcaggccggggcggggcagatcccggcacgccaggccgcggtcaaggcgggcatt
ccgatgagcgtcccggcgctcacgatcaacaaggtgtgtctgtccgggctcgacgcgatc
gcgctcgcggaccagctgatccgcgccggtgagttcgatgtcgtcgtcgccggtggtcag
gagtccatgaccaacgccccgcatctgctgccgaagtcccgtgagggctacaagtacggc
gcggtccagatgatcgacgccatggcgtacgacggtctgacggacgccttcgagaacatc
gccatgggcgagtccacggagaagcacaacacgcggctcgggatcggccgcgcggaccag
gacgccgtggccgccctgtcgcaccagcgggccgccgccgcgcagaagaacgggatcttc
gaggccgagatcacgcccgtggagattccgcagcggcgcggtgagccggtggtcttcagc
caggacgagggcatccgcggcgagacgacggccgagtcgctcggcaagctgcggcccgcc
ttcaccaaggacggcacgatcacggccggttcctcctcgcagatctcggacggtgcggcg
gccgtggtcgtgatgagcaaggccaaggcgcaggagctcggcctggagtggatcgcggag
atcggcgcccacgggaatgtggcgggaccggacaactctttgcagtcgcagccgtccaac
gcgatccagcacgcgctgaagaaggagggtctcgcggtcgacgatcttgatctgatcgag
atcaacgaagccttcgccgcggtcgcggtgcagtcgatgaaggacctcggggtgtccacc
gaaaaggtgaacgtcaacgggggcgcgatcgccctgggacacccgatcggcatgtccggt
gcccggctcgtgctgcacctggcgctggagctgaagcggcggggcggcggcgtgggcgcg
gcggcgctgtgcggtggcggcgggcagggtgacgcgctgatcgtgcgggtacccaaggtc
tga

KEGG   Streptomyces avermitilis: SAVERM_3512
Entry
SAVERM_3512       CDS       T00126                                 

Gene name
fadA2
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_3512 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3512 (fadA2)
   00640 Propanoate metabolism
    SAVERM_3512 (fadA2)
   00650 Butanoate metabolism
    SAVERM_3512 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_3512 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    SAVERM_3512 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_3512 (fadA2)
   00310 Lysine degradation
    SAVERM_3512 (fadA2)
   00380 Tryptophan metabolism
    SAVERM_3512 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_3512 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_3512 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_3512 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_3512 (fadA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVERM_3512 (fadA2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_3512 (fadA2)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: BAC71224
NITE: SAV3512
UniProt: Q82HJ6
Position
4347182..4348405
AA seq 407 aa
MMPEAVIVSTARSPIGRAFKGSLKDLRPDDLTATIIQAALAKVPELDPKDIDDLMLGCGL
PGGEQGHNLGRIVAVQMGMDHLPGCTITRYCSSSLQTSRMALHAIKAGEGDVFISAGVEA
VSRSVKGNSDSLPDTHNPLFAEAEARTAAVAESAGASWHDPREDGLIPDAYISMGQTAEN
LARIKGVTRQDMDEFGVRSQNLAEEAIKNGFWEREITPVTTPDGTVVSKDDGPRAGVTLE
GVQGLKPVFRPDGLVTAGNCCPLNDGAAALVIMSDTKARELGLTPLARIVSTGVTGLSPE
IMGLGPVEASKQALRRAGLTIDDIDLVEINEAFAAQVIPSYRDLGIDLDKLNVNGGAIAV
GHPFGMTGARITGTLINSLQFHDKQFGLETMCVGGGQGMAMVIERLS
NT seq 1224 nt   +upstreamnt  +downstreamnt
gtgatgcccgaagccgtgatcgtctcgaccgcccgctcccccatcggccgcgctttcaag
ggctccctcaaggacctgcgcccggacgacctgaccgccacgatcatccaggccgccctc
gccaaggtccccgagctggaccccaaggacatcgacgacctgatgctcggctgtggcctc
cccggcggtgagcagggccacaacctcggccgcatcgtcgccgtgcagatgggcatggac
cacctcccgggctgcaccatcacccgttactgttcctcctcgctccagacgtcccgcatg
gccctgcacgccatcaaggccggcgagggcgacgtcttcatctccgcgggcgtcgaggcg
gtgtcccgcagcgtcaagggcaactccgacagcctgcccgacacccacaaccccctcttc
gccgaggccgaggcccgcaccgccgccgtcgccgagagcgcgggcgcgtcctggcacgac
ccgcgcgaggacggtctgatcccggacgcgtacatctcgatgggccagaccgccgagaac
ctcgcccgcatcaagggcgtcacccgtcaggacatggacgagttcggcgtccgctcccag
aacctcgccgaggaagccatcaagaacggcttctgggagcgcgagatcacgccggtcacg
acccccgacggcacggtcgtcagcaaggacgacggcccgcgcgccggcgtcaccctggag
ggcgtgcagggcctcaagccggtcttccgccccgacggcctcgtcacggccggcaactgc
tgccccctcaacgacggcgccgccgccctcgtgatcatgtcggacacgaaggcccgcgag
ctcggtctcaccccgctcgcccgcatcgtctccaccggcgtcaccggcctctccccggag
atcatgggcctcggcccggtcgaggcgtccaagcaggcgctccggcgcgcgggcctgacc
atcgacgacatcgacctggtcgagatcaacgaggccttcgccgcccaggtgatcccgtcc
taccgcgacctcggcatcgacctggacaagctgaacgtcaacggcggcgcgatcgccgtc
ggccaccccttcggcatgaccggcgcccgcatcaccggcacgctcatcaattccctccag
ttccacgacaagcagttcggtctggagacgatgtgcgtcggcggcggccagggcatggcg
atggtcatcgagcgcctcagctga

KEGG   Streptomyces avermitilis: SAVERM_5842
Entry
SAVERM_5842       CDS       T00126                                 

Gene name
fadA7
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_5842 (fadA7)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_5842 (fadA7)
   00640 Propanoate metabolism
    SAVERM_5842 (fadA7)
   00650 Butanoate metabolism
    SAVERM_5842 (fadA7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_5842 (fadA7)
   00072 Synthesis and degradation of ketone bodies
    SAVERM_5842 (fadA7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5842 (fadA7)
   00310 Lysine degradation
    SAVERM_5842 (fadA7)
   00380 Tryptophan metabolism
    SAVERM_5842 (fadA7)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_5842 (fadA7)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_5842 (fadA7)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_5842 (fadA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_5842 (fadA7)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVERM_5842 (fadA7)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_5842 (fadA7)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: BAC73554
NITE: SAV5842
UniProt: Q82B63
Position
7049394..7050563
AA seq 389 aa
MAAEPVIVEAVRTPIGKRGGALAHLHPAYLLGETYRELLGRTGIHADCVEQIVGGTVTHA
GEQSMNPARTAWLTMGLPYETAATTVDCQCGSSQQASHMVANMVAAGVIDVGISCGVEAM
SRVPLGSGSKHGPGKPFPDEWNVDLPNQFEAAERIARNRGLTRENVDSLGLISQERAGAA
WSEERFKRETFAVQVPTTEEEQRAGQGMWRLVDRDEGLRDTSMEALAGLKPVMPTAVHTA
GNSSQISDGAAAIMWASKRMARALKLRPRARIVAQALVGADPHFHLDGPIDATRAVLGKA
GMSLKDIDLVEINEAFASVVLSWAQVFEQDLGKVNVNGGAIALGHPVGATGARLITTALH
ELERRDKEFALITMCAGGALATGTIIQRL
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggccgcggaacccgtgatcgtcgaagccgtacgcacccccatcggcaagcgcggtggc
gcgctcgcccatctgcaccccgcctatctcctgggcgagacctaccgtgaactcctcggc
cgcaccggcatccacgccgactgcgtcgagcagatcgtcggaggcacggtgacccacgcg
ggcgagcagtcgatgaaccccgcgcgcacggcctggctcaccatggggcttccgtacgag
acggccgcgacgacggtcgactgtcagtgcgggtcctcgcagcaggcctcgcacatggtc
gccaacatggtcgcggcgggagtgatcgacgtcgggatcagctgcggggtcgaggcgatg
tcgcgggtgccgctcgggtccgggtccaagcacgggccggggaagccgttcccggacgag
tggaacgtggatctgccgaatcagttcgaggcggcggagaggatcgcgcggaaccggggt
ctgacgcgggagaacgtcgactcgctcggactgatctcgcaggagcgggccggggccgcg
tggtcggaggagcgcttcaagcgcgagacgttcgccgtgcaggtgcccacgacggaggag
gaacagcgggccgggcagggcatgtggcggctggtcgaccgggacgaagggctgcgcgac
acgtccatggaggcgctggccggactgaagccggtgatgccgacggcggtccacacggcg
ggcaactcgtcacagatctcggacggggccgccgcgatcatgtgggcgtccaaacggatg
gcgcgtgcgctgaagctgcggccacgggcgcggatcgtggcgcaggcactggtcggggcg
gacccgcacttccacctggacgggccgatcgacgccacgcgggcggtgctcgggaaggcg
ggcatgtcgctgaaggacatcgacctcgtcgagatcaacgaggcgttcgcctccgtggtg
ctgagctgggcgcaggtcttcgagcaggacctggggaaggtgaacgtgaacgggggcgcg
atcgccctcgggcatccggtcggggccacgggggcgcggctcatcacgaccgcgctgcat
gaactggagcggcgcgacaaggagttcgcgctgatcacgatgtgtgcgggcggcgcgctg
gccaccgggacgatcatccagcggttgtag

KEGG   Streptomyces avermitilis: SAVERM_6199
Entry
SAVERM_6199       CDS       T00126                                 

Gene name
fadA3
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_6199 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_6199 (fadA3)
   00640 Propanoate metabolism
    SAVERM_6199 (fadA3)
   00650 Butanoate metabolism
    SAVERM_6199 (fadA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_6199 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    SAVERM_6199 (fadA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_6199 (fadA3)
   00310 Lysine degradation
    SAVERM_6199 (fadA3)
   00380 Tryptophan metabolism
    SAVERM_6199 (fadA3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_6199 (fadA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_6199 (fadA3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_6199 (fadA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6199 (fadA3)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAVERM_6199 (fadA3)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6199 (fadA3)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: BAC73910
NITE: SAV6199
UniProt: Q82A60
Position
7448557..7449714
AA seq 385 aa
MAEAYIVEAVRTPVGRRRGGLAGVHPADLGAHALTALVARSGIDPAAVEDVVFGCLDTVG
PQAGDIARTCWLAAGLPEEVPGVTVDRQCGSSQQAVHFAAQAVLSGTQDLVVAGGVQNMS
QIPIAFASRQAAEPLGLTQGPFAGSEGWRARYGDLPVNQFHGAELIAAKWGITRRDQEEF
ALRSHRRAVRASDEGRFDRETVAYGKVTADEGPRRDTSLEKMAALAPVIEGGTITAACSS
QVSDGAAAMLLASERALREHGLTPRARVHHLSVRGEDPIRMLSAPIPATAHALKKTALAI
DDIDLVEINEAFAPVVLAWLKETGADPEKVNVNGGAIALGHPLGATGVRLMTTLLHELER
TGGRFGLQTMCEGGGQANVTIIERL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggccgaggcctacatcgtcgaagcggtccgtacgcccgtcgggcggcgccggggaggg
ctggccggggtgcacccggcggacctgggcgcgcacgcgctgacggcgctggtcgcacgc
tccggcatcgatcccgccgccgtcgaggacgtggtcttcggctgcctggacacggtcgga
ccgcaggccggcgacatcgcccgcacgtgctggctggccgccggactgcccgaggaggtg
ccgggcgtgacggtcgaccggcagtgcggatcctcccagcaggccgtgcacttcgcggca
caggccgtgctgtccggcacgcaggacctggtggtggcgggcggggtgcagaacatgtcg
cagatacccatcgccttcgcctcccggcaggccgccgagccgctcgggctgacccagggg
cccttcgcgggcagcgagggatggcgggcgcgctacggggacctgcccgtcaaccagttc
cacggcgccgaactgatcgccgcgaaatgggggatcacccggcgtgaccaggaggagttc
gcgctgcgctcgcaccggcgggccgtccgcgcgagcgacgagggacgcttcgaccgggag
accgtggcgtacgggaaggtcacggccgacgaagggccgcgccgggacacctcgctggag
aagatggccgcgctggcgcccgtgatcgagggcggcaccatcaccgccgcctgttcctcg
caggtctccgacggcgcggccgcgatgctgctggcctcggagcgggcgctgcgcgagcac
gggctgaccccgcgtgcccgcgtccaccatctgtccgtgcggggcgaggacccgatccgt
atgctgtcggcgccgattccggcgaccgcgcacgccctgaagaagaccgcgctggccatc
gacgacatcgacctcgtcgagatcaacgaggccttcgcgccggtcgtgctggcctggctc
aaggagacgggcgccgacccggagaaggtcaacgtcaacggcggcgcgatcgccctcgga
catccgctcggcgccacgggcgtgcggctgatgaccacgctgctgcacgaactggagcgc
accggcggccggttcggcctccagacgatgtgcgagggcggcggccaggcgaacgtgacg
atcatcgagcggctctga

DBGET integrated database retrieval system