KEGG   Streptomyces avermitilis: SAVERM_1245
Entry
SAVERM_1245       CDS       T00126                                 

Gene name
echA4
Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00627  Aminobenzoate degradation
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_1245 (echA4)
   00650 Butanoate metabolism
    SAVERM_1245 (echA4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1245 (echA4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1245 (echA4)
   00310 Lysine degradation
    SAVERM_1245 (echA4)
   00360 Phenylalanine metabolism
    SAVERM_1245 (echA4)
   00380 Tryptophan metabolism
    SAVERM_1245 (echA4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1245 (echA4)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_1245 (echA4)
   00281 Geraniol degradation
    SAVERM_1245 (echA4)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1245 (echA4)
   00627 Aminobenzoate degradation
    SAVERM_1245 (echA4)
   00930 Caprolactam degradation
    SAVERM_1245 (echA4)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_1245 (echA4)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAC68955
NITE: SAV1245
UniProt: Q79ZJ7
Position
complement(1543977..1544753)
AA seq 258 aa
MRREGATLVLTLNRPEARNALSLPMLVGLYDGWVEADEDDAVRSVVLTGAGGAFCAGMDL
KALAGQGMEGQQYRDRLQADPDLHWKAMLRHHRPRKPVIAAVEGPCVAGGTEILQGTDIR
VAGESATFGLFEVRRGLFPIGGSTVRLQRQIPRTHALEMLLTGRPYPAREAAGIGLVGHV
VPDGTALAAALEIAGRINACGPLAVEAVKASVYETAEMTETDGLAAELKRGWPVFDTADA
KEGARAFAEKRPPVYRRT
NT seq 777 nt   +upstreamnt  +downstreamnt
gtgcggcgcgagggcgccacactggtgctcacgctcaacaggcccgaggccaggaacgcg
ctctcgctgccgatgctggtcggcctgtacgacggctgggtcgaggccgacgaggacgac
gcggtccgctcggtcgtgctcaccggcgcgggcggtgccttctgcgccgggatggacctc
aaggccctggccggccaggggatggaagggcagcagtaccgggaccggctccaggccgac
cccgatctgcactggaaggcgatgctgcgccaccaccgtccccgcaaacccgtgatcgcc
gccgtcgagggcccctgtgtcgcgggcggcaccgagatcctccagggcaccgacatccgg
gtcgccggcgagtccgcgaccttcgggctgttcgaggtcaggagggggctgttcccgatc
ggaggctccacggtccgcctccagcgccagatcccgcggacccatgccctggagatgctg
ctgaccggacgcccgtacccggcgcgggaggcggccggcatcgggctcgtcggccatgtc
gtccccgacgggaccgccctcgccgcggccctggagatcgccgggcggatcaacgcctgc
ggaccgctcgccgtcgaggccgtcaaggcctccgtgtacgagaccgcggagatgaccgag
accgacggactcgcggccgagctgaagcgcggctggccggtcttcgacaccgccgacgcc
aaggaaggcgcccgcgccttcgccgagaagcgcccgcccgtgtacaggcgcacctga

KEGG   Streptomyces avermitilis: SAVERM_1350
Entry
SAVERM_1350       CDS       T00126                                 

Gene name
echA5
Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00627  Aminobenzoate degradation
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_1350 (echA5)
   00650 Butanoate metabolism
    SAVERM_1350 (echA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1350 (echA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1350 (echA5)
   00310 Lysine degradation
    SAVERM_1350 (echA5)
   00360 Phenylalanine metabolism
    SAVERM_1350 (echA5)
   00380 Tryptophan metabolism
    SAVERM_1350 (echA5)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1350 (echA5)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_1350 (echA5)
   00281 Geraniol degradation
    SAVERM_1350 (echA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1350 (echA5)
   00627 Aminobenzoate degradation
    SAVERM_1350 (echA5)
   00930 Caprolactam degradation
    SAVERM_1350 (echA5)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_1350 (echA5)
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: BAC69060
NITE: SAV1350
UniProt: Q82NF3
Position
complement(1664591..1665361)
AA seq 256 aa
MHSTTEVRTETIGSSLLITIDRPKARNAVNAAVATQLAFAIDQLEADPALRAAVLTGAQG
TFSAGMDLKAALAGESPEIPGRGFGGLTRARTTKPLIAAVEGWAMGGGFELALGCDLIVA
ADDARFGLPEVGRGLIAAGGGVIRLPKRIPYHLAMELLLTGEPVSGERAGQLGIANRVVA
AGETVATALHLAERIAQNAPLALAAVKNLVRAADGAPEEEAFAVQGRLMATLAASADVRE
GMTAFTERRSPVWQGR
NT seq 771 nt   +upstreamnt  +downstreamnt
atgcacagcaccaccgaggtgcggaccgagaccatcggttcgtccctgctcatcaccatc
gaccggccgaaggcgcgcaacgcggtcaacgccgccgtagccactcaacttgctttcgcc
atagaccagttggaggcggaccccgccctgcgcgcagcggtgctcaccggcgcccagggc
acgttcagcgccgggatggacctcaaggccgcgctggccggtgaatcgcccgagatcccg
gggcgcggcttcggcgggctcacccgggcgcggaccaccaagccgctgatcgcggccgtc
gagggctgggcgatgggcggcggattcgaactggccctgggctgcgatctgatcgtcgcc
gcggacgacgccaggttcggtctgccggaggtcggccgcgggctgatcgcggcgggcggc
ggagtgatccggctgcccaagcgcatcccgtaccacctggcgatggaactgctgctcacc
ggcgagccggtctccggcgaacgggccggacagctcggcatcgccaaccgtgtggtcgcg
gcgggggagaccgtcgccaccgcactgcacctggccgagcggatcgcgcagaacgccccg
ctggccctggccgccgtcaagaacctcgtccgcgccgcggacggcgcgcccgaggaggag
gcgttcgccgtacaggggcggctgatggccactctcgcggcctccgccgacgtgcgcgag
ggcatgaccgccttcaccgagcgccgctccccggtctggcagggccggtag

KEGG   Streptomyces avermitilis: SAVERM_1680
Entry
SAVERM_1680       CDS       T00126                                 

Gene name
fadB1
Definition
(GenBank) putative fatty acid oxidation complex alpha-subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_1680 (fadB1)
   00650 Butanoate metabolism
    SAVERM_1680 (fadB1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1680 (fadB1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1680 (fadB1)
   00310 Lysine degradation
    SAVERM_1680 (fadB1)
   00380 Tryptophan metabolism
    SAVERM_1680 (fadB1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1680 (fadB1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_1680 (fadB1)
   00281 Geraniol degradation
    SAVERM_1680 (fadB1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1680 (fadB1)
   00930 Caprolactam degradation
    SAVERM_1680 (fadB1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SAVERM_1680 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_1680 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SAVERM_1680 (fadB1)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored NAD_Gly3P_dh_N NAD_binding_8 ApbA UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: BAC69391
NITE: SAV1680
UniProt: Q82MI0
Position
complement(2056428..2058635)
AA seq 735 aa
MSTEPTTIRWEQDETGIVTLVLDDPNQSANTMNQAFRASIAAIADRAEAEKDSIRGIIYT
SAKKTFFAGGDLKDMMKAGPSDAQRAFETGTAIKNSLRRIETLGKPVVAAINGAALGGGY
EIALASHHRIALDAPGSKIGLPEVTLGLLPAGGGVTRTVRLMGIADALLKVLLQGTQYAP
ARALENGLVHEVAATHEEMLAGARAFIDANPESQQPWDKPGYRIPGGTPANPKFAANLPA
FPANLKKQLNGAPYPAPRNILAAAVEGSQVDFETALVIEARYFTELVTGQTAKNMIQAFF
FDLQAVNSGANRPQGVAPRQVRKVAVLGAGMMGAGIAYSCARAGIEVVLKDVSAEAAAKG
RGYSEKLCAKAVSRGRTTQEKADALLARITPTADPADLAGCDAVIEAVFEDTALKHKVFE
EIEHIVEPDALLCSNTSTLPITALAEGVERQADFIGLHFFSPVDKMPLVEIIKGERTGDE
ALARAFDLVRQINKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASIEQAAAQAGY
PAKVLSLMDELTLTLPRKIRAESKRAVEEAGGTWVTHPAEAVIDRMVDEFGRTGRGGGAG
FYDYVDGKRAKLWPGLREHFTKPGHEIPFEDMQERMLFAEALDTVRLLEEGVLTSVADAN
IGSIFGIGFPGWTGGVLQYINGYAGGPGAGAGAGAGLPGFVARARELAERYGERFTPPAL
LVEKAEKGEHFSDAK
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgagcactgagcccaccaccatccgctgggaacaggacgagaccgggatcgtcaccctc
gttctcgacgaccccaaccagtccgccaacaccatgaaccaggccttcagggcgtcgatc
gcggcgatcgccgaccgcgccgaggccgagaaggactccatccgcgggatcatctacacc
tccgccaagaagaccttcttcgcgggcggcgacctcaaggacatgatgaaggccggcccg
tcggacgcccagcgggcgttcgagaccggtacggcgatcaagaactccctgcgccgcatc
gagaccctgggcaagccggtggtcgccgccatcaacggcgcggccctcggcggcggttac
gagatcgctctcgcctcccaccaccgcatcgccctcgacgcgcccggctccaagatcggc
ctgcccgaggtcaccctcggtctgctcccggcgggcggcggcgtcacccgtaccgtacgc
ctcatgggcatcgccgacgccctcctgaaggtgctcctccagggcacccagtacgcgccc
gcccgcgccctcgagaacggcctcgtccacgaagtcgccgcgacccacgaggagatgctc
gcgggggcccgcgccttcatcgacgccaaccccgagtcccagcagccctgggacaagccg
ggctaccgcatcccgggcggtacccccgccaacccgaagttcgcggcgaacctgccggcc
ttcccggccaacctgaagaagcagctgaacggcgccccctacccggccccgcgcaacatc
ctcgcggccgccgtcgagggctcccaggtcgacttcgagaccgccctggtgatcgaggcc
cgctacttcaccgagctggtcaccggacagaccgccaagaacatgatccaggcgttcttc
ttcgacctccaggccgtcaactccggcgccaaccgcccccagggcgtcgcaccgcgccag
gtccgcaaggtcgccgtactcggcgccgggatgatgggcgcgggcatcgcctactcatgt
gcccgcgcgggcatcgaggtcgtcctcaaggacgtgtccgcggaggccgcggccaagggc
aggggctactccgagaagctgtgcgccaaggcggtctcccggggacgtacgactcaggag
aaggcggacgcgctcctcgcccgcatcacgcccaccgccgaccctgccgacctggcgggc
tgcgacgcggtgatcgaggccgtcttcgaggacacggcgctcaagcacaaggtgttcgag
gagatcgagcacatcgtcgagccggacgccctgctctgctccaacacctccaccctgccc
atcaccgcactcgccgagggcgtggagcgccaggccgacttcatcgggctgcacttcttc
tcgcccgtcgacaagatgccgctcgtcgagatcatcaagggcgagcggaccggcgacgag
gcgctggcgcgcgccttcgacctggtccgccagatcaacaagaccccgatcgtcgtcaac
gactcgcgcggcttcttcacctcccgtgtcatcggccacttcatcaacgagggcgtggcg
atggtcggtgagggcatcgagcccgcgtccatcgagcaggcggccgcgcaggcgggctat
ccggccaaggtcctgtccctcatggacgagttgacgctcaccctgccgcgcaagatccgg
gccgagtcgaagcgggcggtcgaggaggcgggcggcacgtgggtgacccacccggcggag
gcggtcatcgaccgcatggtcgacgagttcggccgcacgggacgcggcggcggtgcgggc
ttctacgactacgtggacggcaagcgcgccaagctgtggcccgggctgcgcgagcacttc
accaagccgggccatgagatccccttcgaggacatgcaggagcgcatgctcttcgccgag
gcgctggacaccgtccggctcctcgaggagggcgtgctgacgtccgtcgcggacgccaat
atcgggtcgatcttcgggatcggtttcccgggctggaccggcggtgtcctccagtacatc
aacgggtacgccggcgggccgggtgccggcgccggggcaggtgccggcctgcccggcttc
gtggcacgggcgcgtgaactcgccgagcgctacggggagcggttcacgccgccggccctg
ctcgtggagaaggcggagaagggcgagcacttcagcgacgcgaagtag

KEGG   Streptomyces avermitilis: SAVERM_3863
Entry
SAVERM_3863       CDS       T00126                                 

Gene name
echA12
Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00627  Aminobenzoate degradation
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_3863 (echA12)
   00650 Butanoate metabolism
    SAVERM_3863 (echA12)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_3863 (echA12)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_3863 (echA12)
   00310 Lysine degradation
    SAVERM_3863 (echA12)
   00360 Phenylalanine metabolism
    SAVERM_3863 (echA12)
   00380 Tryptophan metabolism
    SAVERM_3863 (echA12)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_3863 (echA12)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_3863 (echA12)
   00281 Geraniol degradation
    SAVERM_3863 (echA12)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_3863 (echA12)
   00627 Aminobenzoate degradation
    SAVERM_3863 (echA12)
   00930 Caprolactam degradation
    SAVERM_3863 (echA12)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_3863 (echA12)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAC71575
NITE: SAV3863
UniProt: Q82GN4
Position
complement(4771195..4771929)
AA seq 244 aa
MTLIGITRARGIATLALDSPGNRNALSADLVTELADALTACGKDPDVRAVVLTHSGNTFS
AGADLRQPPDPAAFVGLLRGIVELPKPVVARVTGHVRAGGLGLLGACDIAAGGPGTSFAF
TEVRIGVAPAVISMPLLPRLEPGAARRYYLTGERFGAAEAVRIGLLTASGDDVDETLAPI
LDGLRAAAPGALAETKALVTARVLESFDRDTAALTALSARLFATAEAREGMTAFLERRDP
AWAL
NT seq 735 nt   +upstreamnt  +downstreamnt
atgactctgatcggcatcacgcgcgcgcggggcatcgcgaccctcgccctggactcgccc
ggcaaccgcaacgcgctctcggccgacctggtcaccgaactcgccgacgccctcaccgcg
tgcggcaaggaccccgacgtacgcgccgtcgtcctcacgcactccgggaacaccttcagc
gcgggcgcggacctcaggcagccgcccgacccggcggccttcgtggggctgctgcggggg
atcgtggagctgccgaagccggtcgtcgcgcgcgtgacgggccatgtacgggcgggcggg
ctcggcctgctgggcgcctgcgacatcgcggccggcgggcccgggacgtccttcgcgttc
acggaggtccgcatcggggtcgcgcccgccgtcatctccatgccgctgctgccgcgcctc
gagccgggggccgcccgccgctactacctcacgggggagcgcttcggcgcggcggaggcc
gtacgcatcgggctgctgacggcgtccggcgacgacgtggacgagaccctggcaccgatc
ctggacgggctgcgggcggccgccccgggagccctggccgagacgaaggcactggtcacg
gctagggtgctggaatccttcgaccgggacaccgcggcactgaccgcgctctccgcacgg
ctgttcgccactgccgaggcccgcgaggggatgacggccttcctcgaacgacgggacccc
gcatgggcgctgtga

KEGG   Streptomyces avermitilis: SAVERM_6203
Entry
SAVERM_6203       CDS       T00126                                 

Gene name
echA13
Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00627  Aminobenzoate degradation
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_6203 (echA13)
   00650 Butanoate metabolism
    SAVERM_6203 (echA13)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_6203 (echA13)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_6203 (echA13)
   00310 Lysine degradation
    SAVERM_6203 (echA13)
   00360 Phenylalanine metabolism
    SAVERM_6203 (echA13)
   00380 Tryptophan metabolism
    SAVERM_6203 (echA13)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_6203 (echA13)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_6203 (echA13)
   00281 Geraniol degradation
    SAVERM_6203 (echA13)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_6203 (echA13)
   00627 Aminobenzoate degradation
    SAVERM_6203 (echA13)
   00930 Caprolactam degradation
    SAVERM_6203 (echA13)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_6203 (echA13)
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF5612
Other DBs
NCBI-ProteinID: BAC73914
NITE: SAV6203
UniProt: Q82A56
Position
complement(7452393..7453151)
AA seq 252 aa
MTVSTSFPEKGIAVVTVDFPPVNALPVTGWQDLADAVRAAGRDPRVRCVVLAAEGRGFNA
GVDIKELQANGHSALIGANRGCFEAFAAVYECEVPVVAAVQGFCLGGGIGLAGNADAIVA
SDDASFGLPELDRGALGAATHLARLVPQHLMRALYYTSRTATAAELRAHGSVWKVVPRAE
LHGAALELAREIAAKDGRLLRLAKAAINGIDPVDVRRSYRFEQGFTFEAGLDGVADRVRD
TFGKPSEGQVPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgactgtctccacctcgttcccggaaaaggggatcgccgtcgtcacggtcgacttcccg
ccggtgaacgcactgccggtgaccggctggcaggacctggccgacgccgtacgggcggcg
ggccgcgacccccgggtccgctgtgtcgtactggccgccgaggggcgggggttcaacgcg
ggcgtggacatcaaggagctacaggcgaacggccacagcgccctgatcggcgccaaccgc
ggctgcttcgaggcgttcgcggcggtgtacgagtgcgaggtgcccgtcgtcgcggcggtg
caggggttctgtctgggcggcggcataggcctggcggggaacgcggacgcgatcgtggcg
agcgacgacgcctcgttcgggctccccgagctggaccgcggggcgctgggtgcggccacg
catctcgcgcggctggtcccccagcacctgatgcgcgccctctactacacgtcgcggacg
gcgacggcggccgaactgcgggcgcacggctcggtctggaaggtcgtaccgcgcgcggaa
ctccacggagcggcgctggagctggcccgcgagatcgccgccaaggacggccggctgctg
cggctcgcgaaggccgccatcaacgggatcgacccggtggacgtgcgccgcagctaccgc
ttcgagcagggcttcaccttcgaggccggcctcgacggggtcgccgaccgcgtccgcgac
acgttcgggaagccttcggaagggcaggtgcccaggtga

KEGG   Streptomyces avermitilis: SAVERM_717
Entry
SAVERM_717        CDS       T00126                                 

Gene name
echA3
Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00627  Aminobenzoate degradation
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_717 (echA3)
   00650 Butanoate metabolism
    SAVERM_717 (echA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_717 (echA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_717 (echA3)
   00310 Lysine degradation
    SAVERM_717 (echA3)
   00360 Phenylalanine metabolism
    SAVERM_717 (echA3)
   00380 Tryptophan metabolism
    SAVERM_717 (echA3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_717 (echA3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_717 (echA3)
   00281 Geraniol degradation
    SAVERM_717 (echA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_717 (echA3)
   00627 Aminobenzoate degradation
    SAVERM_717 (echA3)
   00930 Caprolactam degradation
    SAVERM_717 (echA3)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_717 (echA3)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAC68427
NITE: SAV0717
UniProt: Q82Q04
Position
complement(869743..870525)
AA seq 260 aa
MSTAPEAADLVLHERHGGVLTITINRPAQKNAVDHEAAVQLAAAVDLLDADPELSVGVLT
GAGGVFSAGMDLKAFAKGELPLLPSRGLGGLTRASVRKPLVAAVEGWALGGGFELVLACD
LIVAAEDARFGFPEVMRGLVAAEGGLVRLPRRLPYHVAARVLLTGEPLTAVEAKEYGLVN
ELTPPGAALDAARELAGRVARNAPLALAAVKEVLRETQGLKESDAFRRQDELTSGLAASE
DAREGAQAFAEKRAPVWHGR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagcacggcgcccgaagctgccgacttggtgctccacgagcgtcacggcggcgtactg
accatcaccatcaaccgccccgcgcagaagaacgccgtcgaccacgaggccgcggtacag
ctcgcggcggccgtggatctgctcgacgcggacccggagctgtcggtcggcgtcctcacg
ggcgcgggcggggtgttcagcgcgggcatggacctgaaggcgttcgccaagggcgagctg
cccttgctgcccagccggggcctgggcgggctcacccgcgcgtcggtgcgaaagccgctg
gtcgccgcggtcgagggctgggcgctcggcggtggcttcgagctggtcctcgcctgcgac
ctgatcgtcgccgcggaggacgcccgcttcgggtttcccgaggtcatgcgtggtctcgtg
gcggcggagggcggactggtcaggctgccgcgccgacttccgtaccacgtcgccgcgcgc
gtactgctgacgggcgagccgctgaccgccgtcgaagccaaggagtacgggctcgtcaat
gagctgaccccgcccggcgccgcgctggacgcggcccgggagctcgcgggccgcgtcgcg
cggaacgcaccgcttgcactggcggccgtcaaggaggtcctgcgcgagacacagggcctg
aaggagagcgacgcgttcagacgccaggacgagctcacgagcggactggccgccagcgag
gacgcgcgggaaggcgcacaggcgttcgccgagaaacgcgccccggtctggcacggccgc
tga

KEGG   Streptomyces avermitilis: SAVERM_7216
Entry
SAVERM_7216       CDS       T00126                                 

Gene name
echA15
Definition
(GenBank) putative enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00627  Aminobenzoate degradation
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_7216 (echA15)
   00650 Butanoate metabolism
    SAVERM_7216 (echA15)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_7216 (echA15)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_7216 (echA15)
   00310 Lysine degradation
    SAVERM_7216 (echA15)
   00360 Phenylalanine metabolism
    SAVERM_7216 (echA15)
   00380 Tryptophan metabolism
    SAVERM_7216 (echA15)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_7216 (echA15)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_7216 (echA15)
   00281 Geraniol degradation
    SAVERM_7216 (echA15)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_7216 (echA15)
   00627 Aminobenzoate degradation
    SAVERM_7216 (echA15)
   00930 Caprolactam degradation
    SAVERM_7216 (echA15)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_7216 (echA15)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAC74927
NITE: SAV7216
UniProt: Q826H7
Position
complement(8596791..8597558)
AA seq 255 aa
MSVRIERQGYVSTVVLSRPAARNAVDGPTAAELAAAFREFEADETARVAVLWGEGGTFCA
GADLKAVGGERGNRVAQDGDGPMGPTRMTLSKPVIAAVAGHAVAGGLELALWCDLRVAEE
DAVFGVFCRRWGVPLIDGGTVRLPRLIGTSRAMDMILTGRPVPAREAYEMGLANRLVPPG
RARAEAEELAAAIGRFPQDCLRGDRASVLDQEGLDETTAMRGELRHGMRVLAQGVEGAAR
FAAGAGRHGSFGEQG
NT seq 768 nt   +upstreamnt  +downstreamnt
atgtcggtccggatcgaacgccagggatacgtcagcacggtcgtcctctcccgcccggcc
gcccggaacgccgtggacgggccgaccgccgccgagctcgccgccgccttccgggagttc
gaggccgacgagacggcgcgggtggcggtgctgtggggcgagggcggcaccttctgcgcg
ggcgccgatctcaaggcggtcgggggcgagcgcggcaaccgggtcgctcaggacggcgac
gggccgatgggaccgacccggatgacgctgtcgaagccggtgatcgcggcggtcgcgggg
catgccgtggccggcggtctggagctggcgctctggtgcgatctgcgggtcgccgaggag
gacgccgtcttcggggtcttctgccgtcgctggggcgtaccgctcatcgacggcggcacc
gtgcggctcccccggctgatcggcaccagccgggccatggacatgatcctcaccggccgc
ccggtgccggcccgggaggcgtacgagatggggctcgccaaccgcctggtcccgccgggc
cgcgcccgcgcggaggccgaggagctggccgccgccatcggccgcttcccccaggactgc
ctgcgcggcgaccgggcctccgtcctcgaccaggagggcctggacgagacgacggcgatg
cgcggtgaactccgtcacggcatgcgggtactggcccagggcgtggagggcgcggcccgc
ttcgcggcgggcgccggacgccacgggtcgttcggcgagcaggggtga

DBGET integrated database retrieval system