KEGG   Streptomyces avermitilis: SAVERM_1272
Entry
SAVERM_1272       CDS       T00126                                 

Definition
(GenBank) putative dehydrogenase
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_1272
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SAVERM_1272
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C ADH_N_assoc FtsJ TrkA_N Methyltransf_11 Methyltransf_25 Met_10 SdrD_B
Other DBs
NCBI-ProteinID: BAC68982
NITE: SAV1272
UniProt: Q82NN0
Position
complement(1578130..1579200)
AA seq 356 aa
MKALVFHGSGESVWEDVADPGIQDAGDAIVRVDTVTICGTDLHILKGDLPEVRPGTVLGH
EAVGEIVETGGDVRTVRPGDRVLVSCITACGRCRFCRESAYGQCRGGGGWILGHLINGTQ
AEYVRVPHADLSVHPLPGAMDSKDAVLLADILPTAYEVGVLNGRVRPGDTVVVVGAGPVG
LAAVATSRLYTPEKIIAVDLAPARLDAAKRLGADAVAVAGEEAEPLVADLTLGLGADVVI
EAVGVPETFEMCTRMVRPGGHVANVGVHGRPAVLHLEDLWIKNVTITTGLVDTRSTPTLL
RMMAAGHLPASSMVTHTFPLDAMEEAYDVFSRAADTGALKVVLGEQQHDVLMVRAA
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaaagcactcgttttccacggatccggagagtcagtctgggaggacgtggcggacccc
ggtatccaggacgccggcgacgcgatcgtccgtgtcgacaccgtcaccatctgcgggacg
gacctgcacattctcaagggggatctcccggaggtacgccccggcaccgtgctcggtcac
gaggccgtcggtgagatcgtcgaaacgggcggcgacgtacgcacggtccgccccggcgac
cgtgtcctcgtctcgtgcatcacggcgtgcggccgctgccgcttctgccgcgagtcggcg
tacgggcagtgccgcggcggcggaggctggatcctcggccacctgatcaacggcacgcag
gccgaatacgtccgcgtgccccacgccgatctgtccgtgcatccgctgcccggggcgatg
gacagcaaggacgccgttctgctggccgacatcctccccaccgcctacgaggtgggcgtg
ctcaatgggcgggtacggcccggagacaccgtcgtcgtggtcggtgcgggccccgtcggt
ctcgccgccgtcgccacgtcccgcctctacacacccgagaagatcatcgcggtggacctc
gccccggcccggctggacgcggccaaacgcctcggcgcggacgcggtggccgtcgcgggc
gaggaagccgagccactggtcgccgacctcaccctggggctcggggccgacgtcgtcatc
gaagcggtcggggtgcccgagaccttcgagatgtgcacgcgcatggtgcggccgggcggg
cacgtggccaacgtcggcgtgcacggcaggcccgcggtgctgcacctcgaagacctgtgg
atcaagaacgtgacgatcaccaccggactggtcgacacgcgctccactccgaccctgctg
cgcatgatggccgccggccacctgcccgcgtcgtccatggtcacccacaccttcccgctg
gacgccatggaggaggcgtacgacgtcttctcgagggccgccgataccggcgcgctcaag
gtcgtcctcggtgagcagcagcacgacgtcctgatggtcagggcggcctga

KEGG   Streptomyces avermitilis: SAVERM_1393
Entry
SAVERM_1393       CDS       T00126                                 

Gene name
adhA3
Definition
(GenBank) putative alcohol dehydrogenase
  KO
K18382  NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_1393 (adhA3)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SAVERM_1393 (adhA3)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N Shikimate_DH Sacchrp_dh_NADP Methyltransf_31
Other DBs
NCBI-ProteinID: BAC69103
NITE: SAV1393
UniProt: Q82NB0
Position
1719247..1720272
AA seq 341 aa
MKAVQVIEYDEPPALVDVPDPQITGPLDVIVKIGGAGVCRTDLHILEGQWKDKSGVALPY
TIGHENAGWVAEVGQAVTHVKVGDPVILHPLVTCGLCRACRAGDDVHCMNSAFPGIDTAG
GYAEYLKTNARSIVPLAPSLEPASVAALADAGLTAYHAVAKAARVLRPGDKAVVIGAGGL
GHIGIQVLRALSPVEMIVIDRSPEALALAKELGADHTLVADGSEAERVRDLTAGHGAEAV
LDFVGEGGAVETGVACLRRNGNYHVIGYGGRLNVPTIDVISTEINFIGNLVGSYNDLSEL
MVLAAQGKVTLHTQRYPLASFRQALDDLDTGAVRGRAILIP
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaaagccgtgcaggtcatcgagtacgacgagccgcccgcgctcgtggacgtaccggac
ccgcagatcaccggcccgctggatgtgatcgtgaagatcgggggcgccggagtctgccgg
accgatctgcacatcctcgaaggacagtggaaggacaagagcggggtcgcccttccgtac
acgatcggtcatgagaacgccggctgggtcgccgaggtcgggcaggccgtgacccacgtc
aaggtcggtgacccggtcatcctgcacccgctggtgacctgcggtctgtgccgcgcctgc
cgggccggcgacgacgtgcactgcatgaactcggcattccccggcatcgacaccgccggg
ggctacgccgagtacctgaagaccaacgcccgctccatcgtgcccctcgccccgtccctg
gagccggcctcggtggcggccctggccgacgccgggctcacggcgtaccacgccgtcgcc
aaggcggcgcgggtgctgcggcccggtgacaaggccgtggtcatcggcgccggcggactc
gggcacatcgggattcaggtgctgcgggccctgtcgccggtcgagatgatcgtcatcgac
cgcagcccggaggccctcgcgctggccaaggaactgggcgccgaccacacgctcgtcgcg
gacggaagcgaggccgaacgcgtacgggacctcaccgcggggcacggggcggaggccgtc
ctggacttcgtcggcgaagggggcgccgtcgagacgggagtggcctgcctgcgccgcaac
ggcaattaccacgtcatcggttacggcggccgtctgaacgtgccgacgatcgacgtcatc
tccacggagatcaacttcatcggcaacctcgtcgggtcctacaacgacctctccgagctg
atggtcctggcggcccagggcaaggtcaccctgcacacccagcgctaccccctcgcctcc
ttccggcaggccctcgacgacctggacaccggggccgtacgcggccgagcgatcttgatc
ccctga

DBGET integrated database retrieval system