KEGG   Streptomyces avermitilis: SAVERM_1285
Entry
SAVERM_1285       CDS       T00126                                 

Gene name
dak1
Definition
(GenBank) putative dihydroxyacetone kinase subunit 1
  KO
K05878  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaK [EC:2.7.1.121]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_1285 (dak1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     SAVERM_1285 (dak1)
SSDB
Motif
Pfam: Dak1
Other DBs
NCBI-ProteinID: BAC68995
NITE: SAV1285
UniProt: Q82NL8
Position
1594134..1595126
AA seq 330 aa
MKMLINVAETVVADALRGMAAAHPELTVDVEKRVIVRRDAPVAGKVGLVSGGGSGHEPLH
GGFVGPGMLSAACPGEVFTSPVPDQMVRAAAAVDSGAGVLFIVKNYTGDVLNFDMAAELA
EDEGVQVAKVLVNDDVAVTDSLYTAGRRGTGATLFVEKIAGAAAEEGAPLQRVEALARQV
NENARSFGVALSACTTPAKGSPTFDLPDGELELGVGIHGEPGRERRAMMTSREIADFSVH
AILEDLNPSNPVLVLVNGMGATPLLELYGFNAEVQRVLVERGVPVARTLVGNYVTSLDMA
GASVTLCQVDEELLRLWDAPVSTPGLRWGM
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaagatgctcatcaacgtcgcggagacggtggtcgcggacgcgctgcgggggatggcg
gccgcgcatccggagctgacggtggacgtggagaagcgggtgatcgtccggcgcgacgca
ccggtggccggaaaggtcgggctcgtctccggcggcggctcgggacacgagccgctccac
ggcggcttcgtgggcccgggcatgctctcggcggcctgtcccggcgaggtcttcacgtct
cccgtgccggaccagatggtgcgggccgcggccgccgtggacagcggcgcgggtgtgctg
ttcatcgtgaagaactacacgggtgacgtcctgaacttcgacatggcggcggaactcgcc
gaggacgagggcgttcaggtcgcgaaagtcctggtcaatgacgatgtcgccgtcaccgac
agcctgtacacggccggccggcgcggcacgggcgcgaccttgttcgtcgagaagatcgcg
ggcgccgccgccgaggagggcgcgccccttcagcgggtcgaggcactggcccggcaggtc
aacgagaacgcgcgcagcttcggtgtcgccctgagcgcctgcaccaccccggccaagggc
agccccaccttcgacctcccggacggcgagctggagctgggtgtcggcatccacggcgag
ccgggccgggagcggcgcgcgatgatgacctcgcgggagatcgccgacttctcggtgcac
gcgatcctggaggaccttaatccgagcaaccccgtgctggtcctggtcaacggtatggga
gcgaccccactcctggagctgtacggcttcaacgcggaggtgcagcgggtgctggtggag
cgcggtgtcccggtggcacgcacgctcgtcggcaactacgtcacctcgctcgacatggcc
ggcgcctccgtcaccctgtgccaggtcgacgaggagctgctgcgtctgtgggacgcgccg
gtgagcacgcccggcctccgctggggcatgtga

KEGG   Streptomyces avermitilis: SAVERM_1286
Entry
SAVERM_1286       CDS       T00126                                 

Gene name
dak2
Definition
(GenBank) putative dihydroxyacetone kinase subunit 2
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_1286 (dak2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     SAVERM_1286 (dak2)
SSDB
Motif
Pfam: Dak2
Other DBs
NCBI-ProteinID: BAC68996
NITE: SAV1286
UniProt: Q82NL7
Position
1595172..1595771
AA seq 199 aa
MLDADFFRRWMTATAASVDREAERLTALDSPIGDADHGSNLQRGFHAVAVTLEKEAPDTP
GAVLVLAGRQLISTVGGASGPLYGTLLRRTGKELGDTAEVTEEQLTDALRAGVDAVMQLG
GAAPGDKTMIDALVPAVDALSDSFAAGRAAAEEGAVATTPLQARKGRASYLGERSIGHQD
PGATSSALLIAALEEASVE
NT seq 600 nt   +upstreamnt  +downstreamnt
gtgctcgatgccgacttcttccgccgttggatgacggcgaccgccgcgtccgtcgaccgc
gaggccgagcggctcaccgccctcgactcgccgatcggcgacgccgaccacggcagcaat
ctccagcgggggttccacgccgtggcggtcacgctggagaaggaggcgccggacacgccc
ggcgccgtcctcgtgctcgccgggcggcagctcatctcgacggtgggcggcgcctccggg
ccgctgtacggcacgctgctgcgccgcaccggcaaggagctcggggacacggccgaggtc
accgaggaacagctgacggacgcgctgcgcgcgggcgtggacgcggtgatgcagctcggc
ggagccgcgcccggcgacaagaccatgatcgacgcgttggttcccgcggtcgacgcgctc
agtgactcgttcgccgccggccgggccgcggccgaggagggcgccgtcgcgacgacgccc
ttgcaggcccgcaagggccgggcgagctatctgggcgagcggagcatcgggcaccaggat
cccggtgccacctcctcggcgctcctgatcgccgcgctcgaggaggcctccgttgagtga

DBGET integrated database retrieval system