KEGG   Streptomyces avermitilis: SAVERM_1310Help
Entry
SAVERM_1310       CDS       T00126                                 

Gene name
rho2
Definition
(GenBank) putative transcription termination factor
  KO
K03628  transcription termination factor Rho
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_1310 (rho2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_1310 (rho2)
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_1310 (rho2)
Transcription machinery [BR:sma03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     SAVERM_1310 (rho2)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAVERM_1310 (rho2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab Rho_RNA_bind AAA_25 DUF3086 NACHT AAA AAA_22
Motif
Other DBs
NCBI-ProteinID: BAC69020
NITE: SAV1310
UniProt: Q82NJ3
Position
1619721..1620860
Genome map
AA seq 379 aa AA seqDB search
MTTTLEHPPVQQQLPAHATGVLDIAQGGQGYLRTGNCLPTPNDLQVPAALIRRHGLRKGD
VVEGVRGGQRGLTEVASVNGRAPEQLRGRPHFRDLTPLHPRERIRLEHPAGGLSTRVIDL
IAPVGKGQRGLIVAPPKTGKTVLLQQIAAAVAGNHPECHLMVVLLDERPEEVTDMRRSVR
GEVYASTFDRAPKQHIALAELVVERAKRLVEQGQDVVILLDSLTRLCRAHNNTAAAGGRT
LSGGVDAAALQGPKRFFGAARLAEEGGSLTILATALVETGSRADDFFFEELKSTGNMELR
LDRAPAAKRIYPAVDITPSGTRREELLLPSAELAAVRGLRRALQTRDGQANLETLLERLR
ATPDNTAFLRQVQPTLPAA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacactcgaacaccctcccgtacagcagcagctcccggcccacgccaccggt
gtcctcgacatcgcacagggcgggcaggggtacctgcgcaccgggaactgcctgcccact
ccgaacgacctccaggtccccgccgcgctgatccgccgtcacggcctgcgcaagggcgac
gtcgtcgaaggcgtacgcggcggccagcgcggcctcaccgaggtggcgtcggtcaacggc
cgcgcccccgagcagctgcgcggccgcccccacttccgtgacctcaccccgctgcacccc
cgcgaacggatccggctcgaacaccccgcgggcgggctgtccacccgggtgatcgacctg
atcgccccggtcggcaagggccagcgcgggctcatcgtcgccccgcccaagaccggcaag
accgtgctgctccagcagatcgccgcggccgtcgccgggaaccaccccgagtgccacctg
atggtggtgctgctcgacgagcgccccgaggaagtcaccgacatgcggcggtccgtgcgc
ggcgaggtgtacgcctcgaccttcgaccgggcaccgaagcagcacatcgcgctcgccgaa
ctcgtcgtcgaacgggccaagcggctcgtcgaacagggccaggacgtcgtcatcctcctg
gactcgctcacccggctgtgccgggcgcacaacaacacggccgccgccggaggccgcacg
ctcagcggtggtgtcgacgctgccgcgctccagggccccaagcggttcttcggcgcggcg
cgcctggccgaggagggcggttcgctcaccatcctcgccacggccctggtggagaccggc
tcccgcgccgacgacttcttcttcgaggagctcaagagcacgggcaacatggaactccgc
ctcgaccgcgcaccggccgccaagcggatctacccggccgtcgacatcaccccgtccggc
acccgccgcgaggaactcctgctgccttcggccgagttggccgccgtacgaggactgcgc
cgcgccctgcagacccgggacggccaggccaacctcgaaaccctcctggagcgcctgcgc
gccacgccggacaacacggccttcctgcgccaggtccagccgacgctgcccgccgcatag

KEGG   Streptomyces avermitilis: SAVERM_2915Help
Entry
SAVERM_2915       CDS       T00126                                 

Gene name
rho1
Definition
(GenBank) putative transcription termination factor Rho
  KO
K03628  transcription termination factor Rho
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_2915 (rho1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_2915 (rho1)
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_2915 (rho1)
Transcription machinery [BR:sma03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     SAVERM_2915 (rho1)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAVERM_2915 (rho1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rho_RNA_bind ATP-synt_ab Rho_N AAA_25 NACHT AAA VAD1-2
Motif
Other DBs
NCBI-ProteinID: BAC70626
NITE: SAV2915
UniProt: Q82J67
Position
complement(3646335..3648401)
Genome map
AA seq 688 aa AA seqDB search
MSDTTDLMGARVEETAAAPATDASAPATGAGSRRRRGTGLEGMVLAELQQVASGLGIRGT
ARMRKSQLIEVIKEAQAGGGAPAKAAASAADATETKPKRRATSKARTGDDAAPAEKAERA
AKPAAEKAVAQQQIEIPGQPASEDAPAERRRRRATAEAGSPETVAAEAKSEPKAETPAGE
AKGDAADGGEGRQGRRDRRDRGDRGDRGERGDRGDRGERGDRGDRGRDRDRRGNKGDEQQ
GQGGQQRGGGQQQATGRQDRQDRQRDNGPQDDDDFEGGRRGRRGRYRDRRGRRGRDEFGA
NEPQVADDDVLIPVAGILDILDNYAFIRTSGYLPGPNDVYVSLAQVRKNGLRKGDHVTGA
VRQPKDGERREKFNALVRLDSVNGMAPESGRGRPEFNKLTPLYPQDRLRLETDPGVLTTR
IIDLVAPIGKGQRGLIVAPPKTGKTMIMQAIANAITTNNPECHLMVVLVDERPEEVTDMQ
RSVKGEVISSTFDRPAEDHTTVAELAIERAKRLVELGHDVVVLLDSITRLGRAYNLAAPA
SGRILSGGVDSTALYPPKRFFGAARNIEDGGSLTILATALVDTGSRMDEVIFEEFKGTGN
AELKLDRKLADKRIFPAVDVDASGTRKEEILLGSDELAITWKLRRVLHALDQQQAIELLL
DKMKQTKSNAEFLLQIQKTTPMPGNGND
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacaccaccgatctgatgggcgcacgtgtcgaggagaccgctgccgcgcccgcc
acggacgcctccgcgcctgccaccggtgccggctcccggcggcgccgcggtaccggcctc
gagggcatggtgctggccgagctgcagcaggtcgcatccggcctcggcatcaggggcacc
gcgcggatgcgcaagagccagctgatcgaggtcatcaaggaggcgcaggcgggcggcggc
gccccggccaaggcggcagcgtccgccgcggacgccaccgagaccaagcccaagcgccgt
gccacctccaaggctcgtacgggcgacgacgccgcccccgccgagaaggcggagcgggcc
gcgaagcccgccgccgagaaggccgtggcgcagcagcagatcgagatccccggccagccc
gccagcgaggacgccccggccgagcgccgccggcgccgtgccaccgccgaggccggcagc
cccgagacggtcgccgccgaggcgaagagcgagccgaaggccgagacgcccgccggcgag
gccaagggcgacgccgccgacggcggcgagggccgtcagggccgccgcgaccgccgtgac
cgtggcgaccgcggagaccgtggagagcggggcgaccgtggagaccgtggagagcggggc
gaccgcggggaccgcggccgggaccgcgaccgccgtggcaacaagggcgacgagcagcag
ggccagggcggccagcagcgcggcggcggccagcagcaggccaccggccgccaggaccgc
caggaccgtcagcgtgacaacggcccgcaggacgacgacgacttcgagggtggccgccgc
ggtcgccgcggtcgttaccgggaccgccgtggccgccgtggccgcgacgagttcggcgcc
aacgagccgcaggtcgccgacgacgacgtcctgatccccgtcgcgggcatcctggacatc
ctcgacaactacgcgttcatccggacgtccggctacctgccgggtccgaacgacgtgtac
gtctccctcgcccaggtccgcaagaacggcctgcgcaagggcgaccacgtcaccggcgcg
gtccgtcagcccaaggacggcgagcggcgcgagaagttcaacgcgctcgtccgcctcgac
tcggtcaacggcatggcgcccgaatccgggcgcgggcgaccggagttcaacaagctgacg
cccctttacccgcaggaccggctccgcctggagaccgacccgggcgtgctgacgacccgc
atcatcgacctcgtcgcgccgatcggtaagggccagcgcggtctgatcgtggccccgccg
aagaccggcaagaccatgatcatgcaggcgatcgccaacgcgatcacgaccaacaacccc
gagtgccacctgatggtcgtcctggtcgacgagcgtccggaagaggtcaccgacatgcag
cggtcggtgaagggcgaggtcatctcctcgaccttcgaccgcccggccgaggaccacacc
acggtcgccgagctcgccatcgagcgcgccaagcggctggtggagctgggccacgacgtg
gtcgtcctgctcgactcgatcacgcgtctgggccgtgcgtacaacctcgccgcgcccgcc
tccggccgcatcctgtccggtggtgtcgactcgaccgcgctgtacccgccgaagcgcttc
ttcggtgccgcgcgcaacatcgaggacggcggctcgctgaccatcctggccaccgcgctc
gtcgacaccggctcgcgcatggacgaggtgatcttcgaggagttcaagggcaccggcaac
gcggagctcaagctcgaccggaagctcgccgacaagcgcatcttcccggcggtggacgtc
gatgcgtccggcacccgtaaggaagagatcctgctcggcagcgacgagctcgccatcacc
tggaagctgcgtcgcgtgctgcacgcgctcgaccagcagcaggcgatcgagctgctgctc
gacaagatgaagcagacgaagtcgaacgccgagttcctgctccagattcagaagacgacg
ccgatgccgggcaacggcaacgactga

DBGET integrated database retrieval system