KEGG   Streptomyces avermitilis: SAVERM_1314Help
Entry
SAVERM_1314       CDS       T00126                                 

Gene name
glsA
Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00471  D-Glutamine and D-glutamate metabolism
sma01100  Metabolic pathways
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_1314 (glsA)
   00220 Arginine biosynthesis
    SAVERM_1314 (glsA)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAVERM_1314 (glsA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_1314 (glsA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SAVERM_1314 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: BAC69024
NITE: SAV1314
UniProt: Q82NI9
Position
complement(1624746..1625687)
Genome map
AA seq 313 aa AA seqDB search
MVIMSASWSSHAFQPVLERIADEIERTPGRGRPADYIPALAACDPRRFGMAVAELDGTVY
GVGDWRQPFSTQSITKVFTLALDLAREGDALWEHVGREPSGNPFNSLVQLEYESGIPRNP
FINAGALVVTDRLQTQTGDAAGSLLEFLRAESGNPRLTFDQDVAASEAAHGDRNAALGHF
MASYGNIDNSVPVLLDQYFRQCSIEASCADLALATGFLARHGIRADGSRLLTQSQAKQVN
AVMLTCGTYDAAGDFAYRVGLPGKSGVGGGIIAVVPGRCTLCVWSPGLDERGNSVAGVAA
LDRFTTLTGVSVF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcatgtccgcgtcctggtcgtcccacgccttccagccggtcctggagcgcatc
gccgacgagatcgagcgcaccccggggcgcggccggcccgccgactacattccggcgctg
gccgcctgcgacccgcgccgcttcggcatggccgtcgcggagctcgacggcacggtgtac
ggcgtgggggactggcggcagccgttctccacgcagtccatcaccaaggtgttcaccctc
gccctcgacctggcccgcgagggcgacgccctgtgggagcacgtgggccgcgaaccctcc
ggcaacccgttcaactcgctggtccagctggagtacgagagcggcatcccgcgcaacccg
ttcatcaacgcgggcgccctcgtcgtcaccgaccggctccagacacagaccggcgacgcg
gccgggtcgctcctggagttcctgcgcgccgagagcggcaacccccggctgaccttcgac
caggacgtcgccgcctccgaggccgcgcacggcgaccggaacgccgcgctcggccacttc
atggcgtcgtacggcaatatcgacaactccgtgccggtgctcctcgaccagtacttccgg
cagtgctccatcgaggcgtcctgcgccgacctggcgctcgccaccggcttcctggcccgg
cacggcatccgcgccgacggctcccggctgctcacccagagccaggccaagcaggtcaac
gcggtcatgctgacctgcggcacgtacgacgcggcgggcgacttcgcctaccgcgtgggc
ctgcccggcaagagcggcgtcggcggcggcatcatcgcggtcgtccccggccgctgcacg
ctgtgcgtgtggagcccgggcctcgacgagcgcggcaactcggtggcgggcgtcgcggcc
ctcgaccgcttcacgaccctgacgggcgtgtcggtgttctga

KEGG   Streptomyces avermitilis: SAVERM_4139Help
Entry
SAVERM_4139       CDS       T00126                                 

Gene name
purQ
Definition
(GenBank) putative phosphoribosyl formylglycinamidine synthase I
  KO
K23265  phosphoribosylformylglycinamidine synthase subunit PurQ / glutaminase [EC:6.3.5.3 3.5.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00230  Purine metabolism
sma00250  Alanine, aspartate and glutamate metabolism
sma00471  D-Glutamine and D-glutamate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_4139 (purQ)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_4139 (purQ)
   00220 Arginine biosynthesis
    SAVERM_4139 (purQ)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAVERM_4139 (purQ)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SAVERM_4139 (purQ)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     SAVERM_4139 (purQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_5 GATase_3 DJ-1_PfpI GATase Peptidase_C26 SNO
Motif
Other DBs
NCBI-ProteinID: BAC71851
NITE: SAV4139
UniProt: Q82FW3
Position
complement(5079795..5080499)
Genome map
AA seq 234 aa AA seqDB search
MTARIGVVTFPGSLDDRDTQRAIKLAGAEPVALWHKDKDLKQVDAVVLPGGFSYGDYLRA
GAISRFSPVMETVIEQAKSGMPVLGICNGFQILTEAHLLPGAMLGNNHLHFICRDQKLRV
ENADTAWTSDYEAGQEIHIPLKNMDGRYVADERTLDMLEAEGRVAFRYVVGGAAADGYGN
PNGSLRDIAGITNEAGNVVGLMPHPEHAVEPLIGTGRTDGLPFFTSILKKLVNA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcgtattggcgtcgtcactttcccgggcagcctcgacgaccgggacacccag
cgcgcgatcaagctcgccggcgccgaacctgtcgctctctggcacaaggacaaggacctc
aagcaggtcgacgccgtggtgctgcccggcggattctcgtacggcgactatctgcgcgct
ggcgccatctcgcgcttctcgccggtcatggagaccgtcatcgagcaggcgaagtcggga
atgccggtcctcggcatctgcaacggcttccagatcctcaccgaggcccacctcctcccc
ggcgcgatgctcggcaacaaccatctgcacttcatctgccgcgaccagaagctgcgggtg
gagaacgcggacaccgcctggaccagcgactacgaggccggccaggagatccacatcccg
ctgaagaacatggacgggcggtacgtcgccgacgagcggaccctcgacatgctcgaggcc
gagggccgggtcgccttccggtacgtggtcggtggcgcggccgccgacgggtacggcaac
ccgaacggttcgctgcgcgacatcgccggcatcaccaacgaggccgggaacgtcgtcggt
ctcatgccgcaccccgagcacgccgtcgagccgctgatcggtacgggccgtaccgacggc
ctccccttcttcacctcgatcctcaagaagctggtcaacgcatga

DBGET integrated database retrieval system