KEGG   Streptomyces avermitilis: SAVERM_1347
Entry
SAVERM_1347       CDS       T00126                                 

Gene name
gcdH2
Definition
(GenBank) putative glutaryl-CoA dehydrogenase
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1347 (gcdH2)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SAVERM_1347 (gcdH2)
   00380 Tryptophan metabolism
    SAVERM_1347 (gcdH2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1347 (gcdH2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     SAVERM_1347 (gcdH2)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_ox_N
Other DBs
NCBI-ProteinID: BAC69057
NITE: SAV1347
UniProt: Q82NF6
Position
complement(1661612..1662823)
AA seq 403 aa
MTALLPEKTSVDERLAADFYDIESLLPPHERELLTHARAFMRTEVKPLVNEYWAKGEFPR
ELIGKFRDLGLAGVPYEGYGDPLPAGSNLLVGMLSMEYTRTDASSATFFGVHSGLAMYSI
YRGGDQEQRDRWLPSMAALDTIGAFAMTEPLGGSDVAGGMRTTARRDGENWVLNGAKRWI
GNATFADLVVVWARDEADGKVKGFVVEKGTPGFSPVKIENKIAFRIVENAEITLTDVKVP
EANRLQRIDSFRDVAEILRATRSGVAWQALGVMLGAYELALGYAKERKQFGRPIARFQMV
QDLLVKSLGNITACWGMLVQLARLQDAGVFRDEHSSLAKAFVTSRMREVVAWCREIFGGN
GIVLDYDIARFFADAEAIYSFEGTREMNTLIVGKAVTGESAFV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaccgccctgctgcccgagaagacatccgtcgacgagcggttggccgccgacttctac
gacatcgagtcgctgctgccgccgcatgagcgcgaactgctgacgcacgcccgggcgttc
atgcgcaccgaggtcaagccgctggtcaacgagtactgggcgaagggcgagttcccccgc
gagctcatcggcaagttccgcgacctcggactcgcgggcgttccctacgaggggtacggc
gacccgctgccggccgggagcaatctgctggtcggcatgctgtcgatggagtacacccgc
accgacgcctccagtgccacgttcttcggcgtacacagcggcctggcgatgtacagcatc
taccgcggcggcgaccaggagcagcgagaccgctggctgccctcgatggccgcgctggac
accatcggcgccttcgcgatgaccgaacccctcggcggctccgacgtggccggcggcatg
cggaccacggctcgccgggacggggagaactgggtgctcaacggcgccaagcggtggatc
ggcaacgcgacgttcgccgatctggtggtggtctgggcccgcgacgaggcggacggcaag
gtcaagggcttcgtggtggagaagggcaccccgggcttctccccggtgaagatcgagaac
aagatcgcgttcaggatcgtggagaacgccgagatcaccctgaccgacgtcaaggtgccc
gaggccaaccgcctccagcgcatcgactccttccgcgacgtggcggagatcctccgcgcc
acccgcagcggggtcgcctggcaggccctcggcgtgatgctcggcgcctacgagctggcg
ctgggctacgccaaggagcgcaagcagttcggccgcccgatcgcacggttccagatggtg
caggacctgttggtcaagagcctcggcaacatcaccgcctgctggggcatgctggtccag
ctcgcgcgactccaggacgccggtgtcttccgcgacgagcactcctcgctggcgaaggcg
ttcgtcacctcgcggatgcgcgaagtggtggcgtggtgccgggagatcttcggcggcaac
gggatcgtgctcgactacgacatcgcccggttcttcgccgacgcggaggcgatctactcc
ttcgaaggcacccgtgagatgaacacgctcatcgtcggcaaggcggtcaccggcgagagc
gccttcgtctga

KEGG   Streptomyces avermitilis: SAVERM_6542
Entry
SAVERM_6542       CDS       T00126                                 

Gene name
fadE12
Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_6542 (fadE12)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SAVERM_6542 (fadE12)
   00380 Tryptophan metabolism
    SAVERM_6542 (fadE12)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_6542 (fadE12)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     SAVERM_6542 (fadE12)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-ProteinID: BAC74253
NITE: SAV6542
UniProt: Q828W9
Position
7831763..7832938
AA seq 391 aa
MTAFDPADFLGIDDLLDAEDLAIRDTVRTWAAQRVLPYVAEWYENGELPGIRDLARELGA
IGALGMSLTGYGCAGASAVQYGLACLELEAADSGIRSLVSVQGSLAMYALHRFGSEEQKQ
EWLPRMASGDVIGCFGLTEPDHGSDPASMRTYAKRESGGDWVLNGRKMWITNGSVAGVAV
VWAQSDDGIRGFVVPTDAPGFSAPEIKHKWSLRASVTSELVLDDVRLPAAAVLPEVTGLK
GPLSCLSHARYGIVWGAMGAARASFEAAVEYAKTREQFGRPIGGFQLTQAKLADMAVELH
KGILLAHHLGRRMDAGRLRPEQVSFGKLNNVREAIEICRTARTILGANGISLEYPVMRHA
TNLESVLTYEGTVEMHQLVLGKALTGLDAFR
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaccgcgttcgatcccgccgacttccttggcatcgacgacctcctggacgccgaggac
ctcgcgatccgcgacaccgtgcggacctgggcggcgcagcgcgtgctgccgtacgtcgcc
gagtggtacgagaacggcgagctgcccggaatccgggatctggcgcgggagttgggggcc
atcggcgccctcgggatgtcgctcaccggctacggctgcgccggcgcctccgccgtgcag
tacggactcgcctgcctggaactcgaagccgccgactccggcattcgctccctcgtctcc
gtccagggctcgctggccatgtacgccctgcaccgcttcgggtccgaggagcagaagcag
gagtggctgccccggatggcctccggcgacgtcatcggatgcttcggactcaccgagccc
gaccacggctccgacccggcgtcgatgcgcacgtacgccaagcgcgagagcggcggtgac
tgggtcctcaacgggcgcaagatgtggatcaccaacgggtccgtcgccggtgtggccgtc
gtgtgggcgcagtccgacgacgggatccgcggcttcgtcgtgcccacggacgcccccgga
ttctccgcgcccgagatcaagcacaagtggtccctgcgcgcctcggtcaccagcgaactc
gttctcgacgacgtacggctgcccgcggccgccgtcctgcccgaggtcaccggactgaag
ggccccctcagctgtctctcccacgcgcgctacggcatcgtgtggggcgcgatgggggcc
gcgcgcgccagcttcgaggccgccgtcgagtacgcgaagacgcgggagcagttcggcagg
cccatcggcgggttccagctcacccaggccaagctcgccgacatggcggtcgagctgcac
aaggggatcctgctcgcccatcacctggggcggcgcatggacgcgggacggctgcgtccc
gaacaggtcagcttcggcaagctcaacaacgtacgggaggccatcgagatctgccggacc
gctcgcaccatcctcggcgccaacgggatctccctcgagtaccccgtgatgcggcacgcg
accaacctggagtccgtgctcacctacgaaggcaccgtcgagatgcatcaactcgtgctg
ggcaaggcgctcaccggtctcgacgccttccggtga

KEGG   Streptomyces avermitilis: SAVERM_719
Entry
SAVERM_719        CDS       T00126                                 

Gene name
gcdH1
Definition
(GenBank) putative glutaryl-CoA dehydrogenase
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_719 (gcdH1)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SAVERM_719 (gcdH1)
   00380 Tryptophan metabolism
    SAVERM_719 (gcdH1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_719 (gcdH1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     SAVERM_719 (gcdH1)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_ox_N
Other DBs
NCBI-ProteinID: BAC68429
NITE: SAV0719
UniProt: Q82Q02
Position
complement(871760..873001)
AA seq 413 aa
MRETAVSGTTTLPAPSGPYLDKGLLPADFFAYEELLSDGEREQLESVREFLRTQVAPIVD
DYWARAEFPFQLVEGFGRLGLMDWADPDSPESRPSNLLAGFLALELAHVDASVATFAGVH
TGLAMGTILTCGSDEQKRRWLPAMSRFEKIGAFGLTEPHGGSDVAGGLQTTARRDGDTWI
LDGAKRWIGNATFADLVVIWARDVETRHVLGFVVEKDTPGFTATKIENKMALRIVQNADI
VLDGCRVPEANRLQNAHSFKDTAKILRQTRSGVAWQAVGVMFAAYEIALQYTKEREQFGR
PIGGFQLVQDLLVKMLGNATASCGMMTRLAQLQDAGVFRDEQSALAKAYCTVRMRENVGW
ARELLAGNGILLDYKVGRFVADAEAIYSYEGTREIQTLIVGRAVTGGLSAFVR
NT seq 1242 nt   +upstreamnt  +downstreamnt
ttgagggagactgcagtgagcggtacaacgaccttgccggcaccgtccggtccctacctg
gacaaggggctgctgcccgccgacttcttcgcctacgaggaactgctgtcggacggggag
cgagagcagctcgagtccgtccgcgagttcctccgcacgcaggtcgcaccgatcgtcgat
gattactgggccagggccgagttccccttccagttggtcgagggcttcgggaggctcggt
cttatggactgggccgacccggactccccggaatccaggccgagcaacctcctcgcgggc
ttcctcgcgctggagttggcgcatgtcgacgcgtccgtggccacgttcgccggcgtgcac
acgggtctggccatgggcaccatcctcacctgcggctccgacgaacagaagcggcggtgg
ctgccggcgatgagccgcttcgagaagatcggcgccttcgggctgaccgaaccgcacggt
ggctccgacgtggccggcggcctccagacaaccgcgcgccgcgacggcgacacatggatc
ctcgacggcgcgaagcggtggatcggcaacgcgaccttcgccgacctggtcgtcatctgg
gcccgcgatgtcgagacccgtcatgtgctgggcttcgtcgtggagaaggacactcccggg
ttcaccgcgacgaagatcgagaacaagatggcgctgcggatcgtgcagaacgccgacatc
gtgctcgacggctgccgcgttccggaggccaaccggctgcagaacgcgcactcgttcaag
gacaccgccaagatcctgcgccagacacgcagcggcgtggcgtggcaggcggtgggcgtg
atgttcgccgcctacgagatcgccctgcagtacacgaaggaacgggaacagttcgggcgc
cccatcgggggcttccagctcgtgcaggacctgctcgtgaagatgctcggcaacgccacg
gcctcgtgcgggatgatgacgcgcctggcccagttgcaggacgccggggtgttccgggat
gaacagtccgccctggcgaaggcctactgcaccgtgcggatgcgcgagaacgtggggtgg
gcgcgggaactgctggccggcaacggcatcctcctcgactacaaggtcggccgcttcgtc
gccgacgccgaggccatctactcgtacgaaggcacccgggagatccagaccctcatcgtc
ggacgcgccgtgaccggcggcctcagcgccttcgtgaggtga

DBGET integrated database retrieval system