KEGG   Streptomyces avermitilis: SAVERM_1425Help
Entry
SAVERM_1425       CDS       T00126                                 

Gene name
murI
Definition
(GenBank) putative glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00471  D-Glutamine and D-glutamate metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAVERM_1425 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sma01011]
    SAVERM_1425 (murI)
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SAVERM_1425 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:sma01011]
 Precursor biosynthesis
  Racemase
   SAVERM_1425 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race SIS_2 Glyco_transf_4 Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: BAC69135
NITE: SAV1425
UniProt: Q82N78
Position
complement(1758546..1759331)
Genome map
AA seq 261 aa AA seqDB search
MKIALLDSGIGLLAAAAAVRRLRPDADLVLSSDPASVPWGPRTPQDVTERSLAVAEAAAA
HRPDALIAACNTMSVHALPALRARFEPGLPVIGTVPAIKPAAASGGPVAIWATPATTGSP
YQRGLIREFADGVAVTEVPCPGLADAVEHANEAAIDAAIAAAAERTPDDVRVVVLGCTHY
ELVAERIRAAVQKPGLPPLVLHGSAGAVAAQALRRIGELPAPEAPMGASLTVLLGGREET
LPAPALAYEEGQLLQTLSTAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgcgctccttgactccggaatcgggctgctcgcggcagccgccgcggtacgt
cgactgcggcccgacgccgatctcgttctctcctcggaccccgccagcgtgccgtgggga
ccgcgcactccacaggacgtgacggaacgttccctcgccgtcgccgaggcggccgccgcg
caccgcccggacgcgctgatcgccgcctgcaacaccatgtcggtgcacgcccttcccgcg
ttgcgggcccgcttcgaacccggactgccggtcatcggcaccgttccggcgatcaagccc
gccgcggcgagtggcggtccggtggcgatctgggcgacgcccgccaccaccggcagcccg
taccagcgcggtctcattcgggagttcgccgacggagtggcggtcaccgaggtgccgtgt
cccggcctcgccgacgccgtggagcacgcgaacgaagcggccatcgacgccgcgatcgcc
gcggccgcggagcgcaccccggacgatgtaagggtcgttgtcctgggctgcactcattac
gaactcgtcgccgagcgtattcgcgccgccgtgcagaagccgggccttccgccgctcgtc
ctgcacggttccgcaggagcggtggccgcgcaggcgctgcgcaggatcggcgagctgccc
gcgcccgaggcacccatgggcgcctccctcaccgtgctcctcggcgggcgcgaggaaacg
ctgcccgcaccggcactcgcgtacgaggaaggccagctgctgcagaccctcagcacagcg
cgttga

DBGET integrated database retrieval system