KEGG   Streptomyces avermitilis: SAVERM_1476
Entry
SAVERM_1476       CDS       T00126                                 

Definition
(GenBank) putative ROK-family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma00521  Streptomycin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
sma_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1476
   00052 Galactose metabolism
    SAVERM_1476
   00500 Starch and sucrose metabolism
    SAVERM_1476
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_1476
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_1476
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAVERM_1476
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAVERM_1476
SSDB
Motif
Pfam: ROK
Other DBs
NCBI-ProteinID: BAC69186
NITE: SAV1476
UniProt: Q82N27
Position
complement(1819858..1820817)
AA seq 319 aa
MHTDLVAALDIGGTKIAGALVDGHGRILLRAQRATPAQEDGDTVMGAVEDVIGELTGSSL
WGGATAVGIGSAGPVDASAGTVSPVNVPGWRDYPLVERVRKATAGLPVELIGDGVAITAA
EHWQGAARGHDNALCMVVSTGVGGGLVLGGQLHSGPTGNAGHIGHISVDLDGDLCPCGSR
GCVERIASGPNIARRALEGGWQPGPDGDTSAAAVAAAARAGDPVAVASFERAAQALAAGI
AATATLVEVDIAVIGGGVGKAGDVLFTPLRAALRDYATLSFVQRLTVTPAQMGTDAGLVG
AAAAALSRKPSATAVGVSG
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcacaccgacctcgtggccgcgctcgacatcggcggcaccaagatcgccggagcgctg
gtggacggccacggccggatcctgttgcgtgcccagcgcgccacgcccgcgcaggaggac
ggcgacaccgtgatgggtgccgtcgaggacgtcataggcgagttgaccggctcctcgctg
tggggcggggcgacggccgtcggcatcggcagcgcgggccccgtggacgcctccgcgggc
acggtgagccccgtgaacgtgccggggtggcgcgactacccgctggtcgagcgggtccgc
aaggccacggcggggctgcccgtcgagctgatcggcgacggtgtggcgatcacggcggcc
gagcactggcagggcgcggctcgcggccacgacaacgcgctgtgcatggtcgtgtccacc
ggcgtcggcggtggcctggtcctcggcgggcagttgcactcgggccccaccggcaacgcg
ggccacatcgggcacatcagcgtggacctcgacggcgacctgtgcccatgcggttcccgc
ggctgcgtggagcgcatcgcgagcggacccaacatcgcgcgccgcgcgctggagggcggc
tggcagccgggccccgacggtgacacctcggccgccgcggtggccgccgccgcgcgggcg
ggcgacccggtggccgtggcctccttcgagcgggcggcccaggcgctggccgcggggatc
gccgcgaccgcgaccctcgtcgaggtcgacatcgccgtcatcggcgggggagtgggcaag
gcgggggatgtcctcttcacgccgctgcgggccgcgctgcgggactacgccaccctgtcg
ttcgtgcagcggctgaccgtgacgcccgcgcagatgggcacggacgccggtctggtcggc
gccgcggcggccgcgctcagcaggaagccgagcgcgaccgccgtcggggtgagcggctga

KEGG   Streptomyces avermitilis: SAVERM_1980
Entry
SAVERM_1980       CDS       T00126                                 

Definition
(GenBank) putative carbohydrate kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma00521  Streptomycin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
sma_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1980
   00052 Galactose metabolism
    SAVERM_1980
   00500 Starch and sucrose metabolism
    SAVERM_1980
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_1980
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_1980
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAVERM_1980
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAVERM_1980
SSDB
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DEDD_Tnp_IS110
Other DBs
NCBI-ProteinID: BAC69691
NITE: SAV1980
UniProt: Q82LN0
Position
complement(2418954..2420099)
AA seq 381 aa
MSTYRDFTHRGSARATVLRTVGTRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNILE
KLRTETPDKSKSPKVVEDTIVELVLDLSDRHDVHAVGIGAAGWVDADRNRVLFAPHLSWR
NEPLRDRLAGRLAVPVLVDNDANSAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGQV
KRGKFGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAADSPVAYGIIE
HVKGNISEISGPMITELAREGDAMCIELLQDIGQWLGVGIANLAAALDPSCFVIGGGVSA
ADDLLIGPARDAFRRHLTGRGYRPEARIARAQLGPEAGMVGAADLARLVARRFRRANRRR
VERYERYERYVESRRTTKESP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagcacctaccgcgacttcacccaccgcggctccgcgcgggccaccgtcctgcggacc
gtggggacccgtgagcgccgttcccatctgacggcgccgcgcgttcccaccgtcggcatc
gacatcggcggcacgaaggtgatggcgggcgtcgtcgacgcggacggcaacatcctggag
aagctccgcacggagaccccggacaagtccaagagccccaaggtcgtcgaggacacgatc
gtcgagctggtcctggatctgtccgaccggcacgacgtgcacgcggtcggcatcggcgcg
gccggctgggtcgacgcggaccgcaaccgcgtgctgttcgccccccacctgtcctggcgc
aacgagcccctgcgcgaccgcctcgccggacgtctcgcggtccccgtcctggtcgacaac
gacgccaactccgccgcctgggccgagtggcgcttcggcgcgggccgcggcgaggaccat
ctcgtcatgatcacgctgggcaccggcatcggcggcgcgatcctggaggacggccaggtc
aagcgcggcaagttcggtgtggcgggcgagttcggccatatgcaggtcgtgcccggcggc
caccgctgcccgtgcggcaaccgcggctgctgggagcagtacagctccggcaacgcgctc
gtccgggaggcgcgcgagctggccgccgccgactccccggtggcgtacgggatcatcgag
cacgtcaagggcaacatctccgagatcagcggaccgatgatcaccgagctggcccgcgag
ggcgacgcgatgtgcatcgagctgctccaggacatcggccagtggctcggcgtcggaatc
gccaacctcgccgccgccctcgacccgtcctgcttcgtgatcggcggcggcgtctcggcg
gccgacgacctgctgatcggcccggcccgcgacgcgttccgccggcatctcacgggccgc
ggctaccgccccgaggcccgcatcgcccgcgcccagctcggccccgaggccggcatggtc
ggcgccgcggacctcgcgcgcttggtcgcccgccgcttccggcgcgccaaccgacgccgc
gtggagcgctacgagcgctacgagcggtacgtggagtcccgtcgcacgaccaaggagtcg
ccgtga

KEGG   Streptomyces avermitilis: SAVERM_3940
Entry
SAVERM_3940       CDS       T00126                                 

Definition
(GenBank) putative ROK-family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma00521  Streptomycin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
sma_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3940
   00052 Galactose metabolism
    SAVERM_3940
   00500 Starch and sucrose metabolism
    SAVERM_3940
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_3940
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_3940
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAVERM_3940
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAVERM_3940
SSDB
Motif
Pfam: ROK
Other DBs
NCBI-ProteinID: BAC71652
NITE: SAV3940
UniProt: Q82GF7
Position
4864012..4864917
AA seq 301 aa
MKAALVGASGELLHQARRATGRERGPDAVVDTVLGFAAELRAYGERHLGEPAAAAGVAVP
GIVDAGRGLAVYAANLGWSDVPMRKLLGERLHGVPVALGHDVRTGGLAEGRIGAGRGTDR
FLFVALGTGIAGAIGIDGTVEAGAHGFAGEIGHIVVRPGGTPCPCGQYGCLERYASAAAV
SQAWAQASGNPDADAASCAQAVESGDERAVRVWRRAVDALADGLVTALTLLDPRTLIIGG
GLAEAGETLFTPLRAAMERRVTFQKLPALVPAALGDTAGCLGAGLLAWDLLSTHDSPEVT
A
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaaggccgccctggtcggggcctcgggcgagctgctgcaccaggcccgccgggcgacc
gggcgggagcgcggtccggacgccgtggtcgacaccgtcctcggcttcgcggccgaactg
cgcgcgtacggcgagcgtcatctcggcgaacccgcggccgccgccggcgtcgccgtcccc
ggcatcgtcgacgccggccgcggcctcgccgtctacgcggcgaacctcggctggagcgac
gtacccatgcgcaagctcctcggcgaacggctgcacggcgtcccggtcgccctcggccac
gacgtgcgcaccggcggtctcgccgagggccggatcggcgcgggccggggcaccgaccgc
ttcctgttcgtggcgctgggcaccggcatcgcgggcgccatcggcatcgacggcacggtg
gaggcgggcgcgcacggcttcgcgggcgagatcggccacatcgtcgtacgccccgggggg
actccctgtccgtgcgggcagtacggctgcctggagcggtacgcctccgccgcggcggtc
agccaggcctgggcacaggcctccgggaacccggacgcggacgcggcgagctgcgcgcag
gccgtggagtcgggcgacgagcgcgccgtacgggtctggcgccgggccgtggacgcgctc
gccgacgggctggtcaccgcgctcaccctcctggacccgcgcaccctgatcatcggtggc
gggctcgccgaggcgggggaaaccttgttcacaccgctgcgcgcggccatggaacgccgc
gtcaccttccagaagctgccggccctcgtccccgcggccctcggggacacggccggatgt
ctcggcgccgggctgctcgcctgggacctgctctcgacccatgactctccggaggtaacc
gcctga

KEGG   Streptomyces avermitilis: SAVERM_6074
Entry
SAVERM_6074       CDS       T00126                                 

Gene name
glkA1
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma00521  Streptomycin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
sma_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6074 (glkA1)
   00052 Galactose metabolism
    SAVERM_6074 (glkA1)
   00500 Starch and sucrose metabolism
    SAVERM_6074 (glkA1)
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_6074 (glkA1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_6074 (glkA1)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAVERM_6074 (glkA1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAVERM_6074 (glkA1)
SSDB
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N DEDD_Tnp_IS110 FGGY_N
Other DBs
NCBI-ProteinID: BAC73785
NITE: SAV6074
UniProt: Q82AI3
Position
7310940..7311893
AA seq 317 aa
MGLTIGVDIGGTKIAAGVVDEEGNILSTFKVPTPTTPQAIVDAIAAAVEGARAGHEIVGV
GIGAAGYVNRQRSTVYFAPNIHWRQEPLKDEVEARVGLPVVVENDANAAAWGEYKFGAGK
GHRNVICITLGTGLGGGIIIGNKLRRGHFGVAAEFGHIRMVPDGLLCGCGSQGCWEQYAS
GRALVRYAKQRANATPENAEVLLALGNGTPDGIEGKHISVAARQGDPVAVDSYRELARWA
GAGLADLASLFDPSAFIVGGGLSDEGELVLDPIRKSYKRWLVGGNWRPVADVIAAQLGNK
AGLVGAADLAREPDPIM
NT seq 954 nt   +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgacatcggcggcacgaagatcgcggccggcgtggtcgac
gaggaaggcaacatcctctcgaccttcaaggtgccgacccccaccacgccgcaggccatc
gtggacgcgatcgccgctgccgtggagggtgcccgcgcggggcacgagatcgtcggagtg
ggcatcggtgccgcgggctacgtcaaccgtcagcgctccacggtctacttcgcgccgaac
atccactggcggcaggagccgttgaaggacgaggtcgaggcgcgcgtgggcctgccggtc
gtcgtggagaacgacgcgaacgcggcggcctggggcgagtacaagttcggcgcgggcaag
ggccaccgcaacgtcatctgcatcacgctgggcacgggcctcggcggcggcatcatcatc
ggcaacaagctgcgccgcggccacttcggcgtggccgccgagttcggccacatccggatg
gtcccggacggcctgctgtgcggctgcggctcgcagggctgctgggagcagtacgcgtcg
gggcgcgccctcgtgcggtacgcgaagcagcgcgccaacgcgaccccggagaacgcggag
gtcctgctggcgctcggcaacggcaccccggacggcatcgagggcaagcacatctcggtg
gccgcccgccagggcgacccggtcgcggtcgactcctaccgcgagctggcccgctgggcg
ggcgcgggcctcgccgacctggcctccctcttcgacccgtccgccttcatcgtcggcggc
ggcctgtccgacgagggcgagctggtcctcgacccgatccgcaagtcgtacaagcgctgg
ctggtcggcggcaactggcggccggtggccgacgtcatcgcggcccagctcggcaacaag
gcgggcctggtcggcgccgccgacctggcccgggagcccgacccgatcatgtaa

DBGET integrated database retrieval system