KEGG   Streptomyces avermitilis: SAVERM_1527Help
Entry
SAVERM_1527       CDS       T00126                                 

Gene name
ung1
Definition
(GenBank) putative uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_1527 (ung1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_1527 (ung1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SAVERM_1527 (ung1)
DNA repair and recombination proteins [BR:sma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_1527 (ung1)
 Prokaryotic type
     SAVERM_1527 (ung1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAC69237
NITE: SAV1527
UniProt: Q82MX6
Position
complement(1869096..1869773)
Genome map
AA seq 225 aa AA seqDB search
MAPRPLHELVEAGWAKALDPVAGRIAAMGDFLRAEVAAGRTYLPAGANVLRAFQQPFDDV
RVLIVGQDPYPTPGMAIGLSFAVSPEVRSLPGSLENIFRELHTDLGLPRPSNGDLTPWTE
QGVLLLNRALTTAPRKPAAHRGKGWEEVTEQAIRALVARGTPLVSVLWGRDARNLRPLLG
DLPAIESAHPSPMSADRGFFGSRPFSRANELLVRQGAQPVDWRLP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccacgacctttgcatgaactcgttgaagcaggctgggcgaaggctcttgaccct
gtggccggacgcatcgcggcgatgggggacttcctccgggccgaggtggctgccggccgg
acctatctccccgccggggcgaatgtgctgagggcctttcagcagcccttcgacgacgtc
cgcgttctgattgtcggtcaggacccctatcccacgccggggatggccatcgggctgagc
ttcgcagtgtcacccgaggtgcgttcgttgccgggaagcctggagaacatcttccgggaa
ctgcacacggacttggggctgcccaggccgtccaacggcgatctgacgccatggaccgag
cagggggtgctgctgctcaacagggcgctgacgacggccccccgcaagccggcggcgcac
cggggcaagggctgggaagaggtgacggagcaggcgatccgggcactggtggcgcgcggt
acgccgctggtgtcggtcctgtgggggcgggacgcccgcaatctgcggccgctgctcggg
gatctcccggcgatcgagtccgcacatccctcgccgatgtcggccgatcgcgggttcttc
ggctcacgtcccttcagccgggccaatgaactcctggtccgccagggtgcgcagccggtg
gactggcgcctgccttag

KEGG   Streptomyces avermitilis: SAVERM_7011Help
Entry
SAVERM_7011       CDS       T00126                                 

Gene name
ung2
Definition
(GenBank) putative uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_7011 (ung2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_7011 (ung2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SAVERM_7011 (ung2)
DNA repair and recombination proteins [BR:sma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_7011 (ung2)
 Prokaryotic type
     SAVERM_7011 (ung2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAC74722
NITE: SAV7011
UniProt: Q827B3
Position
8371165..8371848
Genome map
AA seq 227 aa AA seqDB search
MTDTAMLPESWRGVLGDELQQPYFKELTEFVEEERARGPVYPPREEVFAALAATPYERVK
VLVLGQDPYHGEGQGHGLCFSVRPGVKTPPSLRNIYKEMKEELGTPIPDNGYLMPWAEQG
VLLLNAVLTVRSGEANSHKGKGWEKFTDAVIRAVADRPDPAVFVLWGNYAQKKLPLIDEE
RHVVVKGAHPSPLSAKKFFGSRPFTQINEAVAEQGHTPIDWTIPNLG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaccgccatgctgcccgagtcctggcgcggcgtcctgggcgacgagctgcag
cagccctacttcaaggaactcaccgagttcgtcgaggaggagcgcgccaggggtcctgtc
taccctccgcgtgaggaggtcttcgccgcgctcgcggcgacgccgtacgagcgggtgaag
gtgctggtcctcggccaggacccgtatcacggcgagggccaggggcacggtctgtgcttc
tccgtccggccgggcgtgaagacgccgccctcgctccgcaacatctacaaggagatgaag
gaggagctgggcaccccgatcccggacaacggctatctgatgccgtgggccgagcagggt
gtgctgctgctcaacgcggtgctgacggtgcgctccggcgaggcgaactcgcacaagggc
aagggctgggagaagttcacggacgccgtgatccgcgcggtcgcggaccggcccgacccg
gcggtcttcgtgctgtggggcaactacgcgcagaagaagctgccgctcatcgacgaggag
cggcacgtggtggtgaagggcgcgcatccctctccgctgtccgcgaagaagttcttcggt
tcgcgtcccttcacgcagatcaacgaggcggtcgcggagcaggggcacaccccgatcgac
tggacgattcccaacctcggctga

DBGET integrated database retrieval system