KEGG   Streptomyces avermitilis: SAVERM_1531
Entry
SAVERM_1531       CDS       T00126                                 

Gene name
nos
Definition
(GenBank) putative nitric oxide synthase
  KO
K00491  nitric-oxide synthase, bacterial [EC:1.14.14.47]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_1531 (nos)
   00330 Arginine and proline metabolism
    SAVERM_1531 (nos)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.47  nitric-oxide synthase (flavodoxin)
     SAVERM_1531 (nos)
SSDB
Motif
Pfam: NO_synthase Neisseria_TspB
Other DBs
NCBI-ProteinID: BAC69241
NITE: SAV1531
UniProt: Q82MX2
Position
complement(1873463..1875013)
AA seq 516 aa
MADPSGVGRGRGVWTADGSGTGSITGLQGRLLADAPPESAASRPGGDARDRHGAPSRARG
WSTETWCAPHGRKDTAGESEHRPPGPTLPGARGWGAARTRGDRPDGHPDHPTGSPTTDGP
ARPARPDRREEGDGHDGHEGQDGHDGHDLLCAATAFLTLHHTEERLGDPARRIAAAHAEI
AETGTYRHTTEELVFGARVAWRNANRCIGRLYWHSLCVRDRRDVRDAKDVAEASADHLRE
ATRDGRIRALITVFAPDAPGRPGPRIWNEQLIRYAGYARPGGAVTGDPRNAGLTALARRL
GWPGGPGSPFDVLPLIVQSAGDRPRWFTLPEDAVLEVALTHPEYPWWRSLGLRWHAVPAL
AGMCLESGGICYPAAPFNGWYMGTEIGARNLADADRYDLLPHLADRLGLDTRSDRSLWKD
RALVELNRSVLHSFDRAGVTVTDHHTESLRFLTHLDREERKGRRVGADWSWIVPPISGSA
TPVFHRTYETVERHPAYVHHPEALARARGEIDEILV
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggccgacccatccggtgtcgggcggggccggggcgtatggacggccgacggatccggt
accggatcgatcacgggcctccagggccgcttactggccgacgctccgccggaaagtgcc
gcgagtcgaccgggcggggacgcgcgcgatcggcacggcgcgccctcccgcgcacgcggc
tggagcacggagacgtggtgcgcgccgcacggtcgcaaggacaccgcgggggagtccgag
cacagaccccctgggccgaccctcccaggcgcccgcgggtggggcgcggcgcgcacccgc
ggtgaccgcccggacgggcatccggaccacccgaccggcagccccaccaccgacgggccg
gcccggcccgcccggcccgaccggcgtgaagaaggcgacggccatgacgggcacgagggc
caggacggtcacgacgggcacgatctcctctgcgccgccaccgcgttcctcaccctccac
cacaccgaagaacgcctcggcgacccggcccgccgcatcgccgccgcgcacgcggagatc
gcggagacagggacgtaccgacacaccacggaagaactggtcttcggcgcccgggtcgcc
tggcggaacgccaatcgatgcatagggcggctgtactggcactccctgtgcgtacgcgac
cgccgggacgtgcgggacgcaaaggacgtcgccgaggcttcggcggaccacctgcgggag
gccacccgggacggccgtatccgcgccctgatcacggtgttcgcacccgacgcgcccggc
cgtccaggaccgcggatctggaacgagcagctcatccggtacgccggctacgcccgcccc
ggcggcgcagtcaccggtgacccgcgcaacgccggtctgaccgcgctcgcccgtcgcctc
ggctggcccggcggccccggcagcccgttcgacgtgctgccgctgatcgtgcagagcgcg
ggcgaccggccccgttggttcacgctgcccgaggacgccgtgctcgaagtggcgctcacg
caccccgagtacccctggtggcggtcgctcggactgcgctggcacgcggtgcccgccctg
gccggcatgtgtctggagagcggcggcatctgctacccggcggcccccttcaacggctgg
tacatgggtaccgagatcggcgcccgcaacctcgccgacgccgaccgctacgacctcctg
ccgcacctcgccgaccgcctcggcctcgacacccgcagcgaccgctccctgtggaaggac
cgcgcgctcgtcgagctcaaccgctccgtcctgcactccttcgaccgcgccggtgtcacc
gtcaccgatcaccacaccgagtcccttcgtttcctcacccacctggaccgcgaggagcgc
aagggccgccgggtcggtgccgactggtcctggatcgtgccgccgatctccggcagcgcc
accccggtcttccaccgcacgtacgagacggtggaacggcaccccgcctacgtccaccat
ccggaggcgctggcccgggcgcgcggtgagatcgacgagattctggtctag

DBGET integrated database retrieval system