KEGG   Streptomyces avermitilis: SAVERM_1542
Entry
SAVERM_1542       CDS       T00126                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1542
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     SAVERM_1542
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored ApbA 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN 3HCDH_N Shikimate_DH Sacchrp_dh_NADP OCD_Mu_crystall NAD_binding_10 Rossmann-like NAD_binding_8 NmrA Epimerase UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: BAC69253
NITE: SAV1542
UniProt: Q82MW0
Position
complement(1885125..1886015)
AA seq 296 aa
MTDTLTVSVLGTGIMGAAMARNLARAGHTVRAWNRTRAKAEPLAADGAHIADTPAEAVEG
ADVVLTMLHDGDAVLGVMRQAAPALRPGTAWIQSTTAGLDALTGLADFAREHRLAFFDAP
VLGTRQPAEAGQLVVLAAGPTESRETVTPVFDAVGSRTLWTGEDGAAGSATRLKLVANSW
VIAATNATGEVLALAKALGVDPQNFFDAIAGGPLDMGYLHAKADLVLNNGLTPASFAVST
AEKDARLIVQAGQEHGVRLDGAEASAERLHRAAAQGHADEDMAAVYYASFDETRTP
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaccgacaccctcaccgtgagcgtcctcggcaccggaatcatgggagcggcgatggcc
cgcaacctcgcccgggccggacacaccgtccgggcctggaaccgcacccgcgccaaggcc
gagccgctggccgccgacggtgcgcacatcgccgacaccccggccgaggccgtggagggc
gccgacgtcgtcctcaccatgctgcacgacggtgacgccgtcctgggcgtcatgcgccag
gccgcccccgccctgcgccccgggaccgcctggatccagtcgaccaccgccggcctcgac
gccctcaccggcctcgccgacttcgcccgcgagcaccggctggccttcttcgacgccccc
gtcctcggcacccgccagcccgccgaagccggacagctcgtcgtcctcgccgccggcccc
acggagagccgggagaccgtgacgcccgtgttcgacgccgtcggctcccgcacgctgtgg
accggcgaggacggcgcggccggcagtgccacccgcctcaagctcgtggccaacagttgg
gtcatcgccgccaccaacgccaccggagaggtcctcgccctggccaaggccctcggcgtg
gacccgcagaacttcttcgacgccatcgccggcggccccctcgacatgggctatctgcac
gccaaggccgacctcgtcctcaacaacggtctcaccccggccagcttcgccgtgagcacg
gccgaaaaggacgcccgcctgatcgtccaggccggacaggagcacggcgtccgcctcgac
ggagccgaggcctccgccgaacgcctccaccgcgccgccgcccagggccacgccgacgaa
gacatggccgcggtctactacgccagcttcgacgagacacggaccccctga

DBGET integrated database retrieval system