KEGG   Streptomyces avermitilis: SAVERM_1604
Entry
SAVERM_1604       CDS       T00126                                 

Gene name
pcaF1
Definition
(GenBank) putative beta-ketoadipyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00362  Benzoate degradation
sma00592  alpha-Linolenic acid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1604 (pcaF1)
   00592 alpha-Linolenic acid metabolism
    SAVERM_1604 (pcaF1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1604 (pcaF1)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SAVERM_1604 (pcaF1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1604 (pcaF1)
   00642 Ethylbenzene degradation
    SAVERM_1604 (pcaF1)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SAVERM_1604 (pcaF1)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Other DBs
NCBI-ProteinID: BAC69315
NITE: SAV1604
UniProt: Q82MQ6
Position
complement(1970941..1972128)
AA seq 395 aa
MRPVHFAAARRTPIGKLRGALSVVRPDDLAATVIRGLIADLPGLDPARIDDVYWGAANQA
GEDNRNVARMAALLAGLPESVPGATVNRLCASGLEAVTTAARTIAAGEADIVLAGGSESM
SRAPFVLPRPDEALPHRIETVDTRLGWRLVNPAMKELHGLLSMGETAEEVAERYAVPRER
QDEFALRSHRRAADARKNGYFDDELLPVTRPDGVVVADDECVREDTSYEKLSRLKPVFRQ
GGTVTAGNASPMNDGAAGLLLVSEEALNELGLESLGQYVAGASAGVHPDVMGIGPVPATE
KALARVGWTIGDIEEAEFNEAFAAQALACVDRLGIDPELVNPTGGAIALGHPLGCSGARI
LTTLLHRMRRTGAARGLATMCVGVGQGSAILVERH
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgcgtcccgtccacttcgcggcagctcgccgcacccccatcggcaagctgcgcggcgcc
ctgtccgtcgtgcggcccgacgacctcgcggcgacggtgatacgcggtctgatcgccgac
ctgcccgggctcgacccggcccgtatcgacgacgtgtactggggcgcggccaaccaggcc
ggcgaggacaaccgcaatgtcgcccgcatggccgccctcctcgccgggctgcccgagtcg
gtgcccggcgccacggtcaaccggctctgtgcctccggtctggaggcggtgaccacggcc
gcccgcacgatcgccgccggcgaggccgacatcgtgctcgcgggcggctccgagtccatg
agccgcgcccccttcgtgctgccccgcccggacgaggccctgccgcaccgcatcgagacc
gtcgacacccggctcggctggcgcctggtcaacccggccatgaaggaactgcacggcctg
ctctccatgggtgagaccgccgaggaggtcgccgaacggtacgcggtcccgcgcgaacgc
caggacgagttcgcgctgcgcagtcaccggcgcgccgcggacgcccgcaagaacgggtac
ttcgacgacgagctgctgcccgtcacccggcccgacggcgtggtcgtcgccgacgacgag
tgcgtacgcgaggacacctcgtacgagaagctgtcccgtctcaagccggtgttccgccag
ggcggcaccgtcaccgccggcaatgcctcgccgatgaacgacggagcggccggactcctc
ctcgtcagcgaggaggccctgaacgagctgggtctggagtccctgggacagtacgtcgcc
ggcgcctcggccggtgtccatcccgacgtcatgggtatcggccccgtgcccgcgaccgag
aaggccctggctcgcgtcggctggacgatcggcgacatcgaagaggccgagttcaacgag
gcgttcgccgcccaggccctcgcctgcgtggaccgcctcggcatcgacccggagctcgtc
aaccccaccggcggcgccatcgccctcggtcacccgctcggctgctcgggcgcccgcatc
ctcaccacgctgctccaccgcatgcgccgcaccggcgcggcccgcggcctggccacgatg
tgcgtcggggtcgggcagggcagtgcgatcctcgtcgaacgccactga

DBGET integrated database retrieval system