KEGG   Streptomyces avermitilis: SAVERM_1615Help
Entry
SAVERM_1615       CDS       T00126                                 

Gene name
xylE
Definition
(GenBank) putative catechol 2,3-dioxygenase
  KO
K00446  catechol 2,3-dioxygenase [EC:1.13.11.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00361  Chlorocyclohexane and chlorobenzene degradation
sma00362  Benzoate degradation
sma00622  Xylene degradation
sma00643  Styrene degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1615 (xylE)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SAVERM_1615 (xylE)
   00622 Xylene degradation
    SAVERM_1615 (xylE)
   00643 Styrene degradation
    SAVERM_1615 (xylE)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.2  catechol 2,3-dioxygenase
     SAVERM_1615 (xylE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Peptidase_C36
Motif
Other DBs
NCBI-ProteinID: BAC69326
NITE: SAV1615
UniProt: Q82MP5
Position
complement(1982532..1983482)
Genome map
AA seq 316 aa AA seqDB search
MTPPLGDIAHLGHVELLTPDLDRSVRFFTDILGLTVNGTSGDSVYLRTWDDYEHHSLILT
AHGKPGMRRTALRASSEEALQRRVKDLENTGRGGRWVEDEPGIGPLYVSSDPDGHELALY
WESEWYEAPPELKPGLKNQPQAKPGQGVGVRRLDHVNFLASDVAANAAFTREVLGARATE
QIVLDSGKVAAQWLTFTNKSYDVVYTSDWTGSSGRLHHVAFATDNRDDILRAADLCLDND
VFIETGPHKHAIQQTFFLYVYEPGGNRIELCNPLTRLVLAPDWPLITWTEAERAKGQAWG
LKTIESFHTHGTPPVD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgactccgcccctcggagacatcgcccacctcgggcacgtcgaactgctcaccccggac
ctggaccgcagtgtccggttcttcaccgacatcctcgggctgaccgtcaacggcacctcc
ggagactccgtctacctgcggacctgggacgactacgagcaccacagtctgatcctcacc
gcgcacgggaagccggggatgcgccgcacggccctgcgcgcctccagcgaggaggccctt
cagcgccgggtcaaggatctggagaacaccggccgcgggggtcgctgggtcgaggacgaa
ccgggcatcggcccgctgtacgtctccagtgatcccgacggccacgaactcgccctgtat
tgggagagcgagtggtacgaggcaccgcccgagctgaagccgggtctgaagaaccagccc
caggccaagcccggccagggcgtgggcgtgcgccgcctggaccacgtcaacttcctcgcc
tccgacgtcgcggccaacgcggccttcacccgggaggtgctcggcgcccgcgccaccgag
cagatcgtgctcgacagcgggaaggtggccgcccagtggctcaccttcaccaacaagtcg
tacgacgtcgtctacacctcggactggacgggttccagcggacggctgcaccacgtcgcg
ttcgcgaccgacaaccgtgacgacatcctgcgcgccgccgacctctgcctcgacaacgac
gtgttcatcgagaccggtccgcacaagcacgccatccagcagacgttcttcctgtacgtc
tacgagccgggcggcaaccgcatcgagctgtgcaacccgctcacccgtctggtgctggcc
cccgactggccgctgatcacctggaccgaggccgagcgggccaaggggcaggcctggggc
ctgaagaccatcgagtccttccacacccacggcacaccgcccgtcgactga

DBGET integrated database retrieval system