KEGG   Streptomyces avermitilis: SAVERM_1616
Entry
SAVERM_1616       CDS       T00126                                 

Definition
(GenBank) putative transmenmbrane protein
  KO
K16514  4-oxalomesaconate tautomerase [EC:5.3.2.8]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1616
Enzymes [BR:sma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.8  4-oxalomesaconate tautomerase
     SAVERM_1616
SSDB
Motif
Pfam: PrpF Pro_racemase
Other DBs
NCBI-ProteinID: BAC69327
NITE: SAV1616
UniProt: Q82MP4
Position
complement(1983493..1984566)
AA seq 357 aa
MLMRGGTSKGAYFLAEDLPADAGARDDLLLRVMGSPDPRQIDGLGGAHPLTSKVAVVSVS
ADPEADVGYLFLQVGVDTAQVTDRQNCGNLLAGVGPFAVERGLVAPGDAETSVRIRMLNT
GDLAVATFPTPGGRVDYTGSAEISGVPGTAAPVVIEFPPGGSPLLPTGLARDVVAGTPVT
CVDNGMPTVLIAASSLNVKGYEDPKDLEEDVALADRLRAIRLEAGRLMGLGDVDGTTVPK
LSLLAPPLHGGAIMTRTFIPVRCHTSIGVLGAASVAAGLRVEGGVGQDLARLPAHGDRLR
IEHPTGFLDLETSIEHGAAGAVPVARRTAVVRTARKIFDGTVFPRSAATAPTPARHS
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgctcatgcgcggcggcacctccaagggggcctacttcctggccgaggacctgcccgcc
gacgccggcgcgcgcgacgacctgctgctgcgcgtcatgggcagccccgatccgcgccag
atcgacggcctgggcggggcgcatcccctgaccagcaaggtggccgtcgtctccgtctcc
gccgaccccgaggcggacgtcggctatctgttcctccaagtcggcgtcgacaccgcccag
gtgaccgaccggcagaactgcggcaacctgctcgccggggtcggccccttcgccgtggaa
cgcgggctggtcgccccgggggacgcggagacgtccgtacggatccgcatgctcaacacc
ggggacctggccgtcgcgacctttcccaccccggggggacgcgtcgactacaccggctcg
gccgagatctccggtgtgccggggaccgccgccccggtggtcatcgagttcccgccgggc
ggcagtccgctgctgcctacagggctggcccgtgacgtcgtcgccggcaccccggtgacc
tgcgtggacaacggaatgccgaccgtgttgatcgccgcttcctcactgaacgtcaagggc
tacgaggaccccaaggacctggaggaggatgtggccctcgccgaccggctccgggcgatc
cggctggaggccggacggctgatggggctcggtgacgtcgacggcaccaccgtgcccaaa
ctcagcctcctggcaccgcccctgcacggcggcgcgatcatgacccgcaccttcatcccg
gtgcgctgccacacctccatcggtgtcctgggcgccgcgagtgtggccgccgggctgcgc
gtcgaggggggcgtcggccaggacctggcgcgcctgcccgcacacggggaccgattgcgc
atcgagcaccccaccgggttcctcgacctcgaaaccagcatcgagcacggcgccgcgggc
gcagtgccggtggcccgccggaccgccgtcgtgcgtaccgcgcgaaagatcttcgacggc
accgtcttcccccggtccgccgcaaccgcgccgacacccgcgcgccacagctaa

DBGET integrated database retrieval system