KEGG   Streptomyces avermitilis: SAVERM_1617
Entry
SAVERM_1617       CDS       T00126                                 

Definition
(GenBank) putative dimethylmenaquinone methyltransferase family protein
  KO
K10218  4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC:4.1.3.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma00660  C5-Branched dibasic acid metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SAVERM_1617
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1617
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.17  4-hydroxy-4-methyl-2-oxoglutarate aldolase
     SAVERM_1617
SSDB
Motif
Pfam: RraA-like
Other DBs
NCBI-ProteinID: BAC69328
NITE: SAV1617
UniProt: Q82MP3
Position
complement(1984590..1985300)
AA seq 236 aa
MSGVIVTNPPKADAKDVESLSGYGVATVHEALGRSGLLGPDLRPIQQGVRICGSAVTVLS
WPGDNLMIHAAVEQCGEGDLLVVTTTSPSTDGMFGELFATALQRRGVRGLVTNAGVRDTE
ELREMGFPVWARAVSSQGTVKATGGSVNVPVAIGGQTVRPGDVILADDDGVMCVPRERSA
RAVEASAARTAKEEASRAAFAKGELGLDRYGLRDTLARLGVEYRTYEEYAREEAGS
NT seq 711 nt   +upstreamnt  +downstreamnt
atgagcggcgtgatcgtcaccaacccgcccaaggcggatgcgaaggacgtcgagtcgctg
tccggctacggcgtggccacggtccacgaggcgctcggccgcagcggcctcctcggcccc
gacctgcgccccatccagcagggcgtacggatctgcggcagcgccgtcaccgtactcagc
tggcccggcgacaacctcatgatccacgcggcggtggagcagtgcggcgagggcgacctc
ctggtcgtcaccaccacctctccctccaccgacggcatgttcggcgagctgttcgccacc
gccctccaacggcggggcgtgcgcggcctggtgaccaacgcgggcgtgcgggacaccgaa
gaactgcgtgagatgggcttcccggtgtgggcgagggccgtgagctcccagggcaccgtg
aaggccaccggcggctcggtcaacgtaccggtcgcgatcggcgggcagacggtccggccc
ggcgatgtgatcctcgccgacgacgacggtgtcatgtgtgtgccccgcgagcggtccgcc
cgggccgtcgaggcgtccgccgcccgcaccgccaaggaagaggcgtcccgcgccgccttc
gccaagggcgagctgggcctcgaccgctacggactgcgcgacaccctcgcccggctcggc
gtcgagtaccgcacctacgaggagtacgcccgcgaggaggcgggctcgtga

DBGET integrated database retrieval system