KEGG   Streptomyces avermitilis: SAVERM_1618
Entry
SAVERM_1618       CDS       T00126                                 

Definition
(GenBank) hypothetical protein
  KO
K16515  4-oxalomesaconate hydratase [EC:4.2.1.83]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1618
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.83  4-oxalomesaconate hydratase
     SAVERM_1618
SSDB
Motif
Pfam: PIG-L
Other DBs
NCBI-ProteinID: BAC69329
NITE: SAV1618
UniProt: Q82MP2
Position
complement(1985297..1986046)
AA seq 249 aa
MTHGNAPATPRSTLVITAHAGDFVWRAGGAIALAASRGEKVTIACLTFGERGESAKAWRE
GKSLEEIKGIRREEAEKAAATLGAEVVFFDAGDYPLLATPELTDRLVAVHRQAQPDVVLT
HPLDDPYNGDHPAAARMALDARVLAQAIGYPAPGEIIGAPPVFFFEPHQPEMCGFKPEVL
LDITEVWETKRKAMECLAAQQHLWDYYTDLGKRRGVQLKRNAGPNLGLPHATYAEAYMRP
YPQVTGELA
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacgcacggcaacgcgcccgccaccccacggtccacactcgtcatcaccgcgcacgcc
ggggacttcgtgtggcgagcgggcggagccatcgccctggcggcgtcccgcggcgagaag
gtcaccatcgcgtgtctgaccttcggtgagcgcggcgaatccgccaaggcgtggcgcgag
ggcaagtcgctggaggagatcaaggggatccggcgcgaggaggccgagaaggcggccgcc
accctcggcgccgaggtcgtcttcttcgacgccggcgactaccccctgctcgccacgccc
gagttgaccgaccggctggtggccgttcaccggcaggcccagccggacgtcgtgctcacc
caccccctcgacgacccctacaacggcgaccacccggcggcggctcggatggccctggac
gcgcgcgtgctcgcccaggccatcggctacccggcccccggggagatcatcggggccccg
ccggtgttcttcttcgagccgcaccagcccgagatgtgcgggttcaagccggaggtcctc
ctcgacatcaccgaggtgtgggagaccaagcgcaaggccatggagtgcctggccgcccag
cagcacctgtgggactactacaccgacctgggcaagcgccgcggtgtccagctcaagcgc
aacgccggacccaacctcggtctgccgcacgccacgtacgccgaggcgtacatgcgtccc
tacccgcaggtcacgggggagctggcatga

DBGET integrated database retrieval system