KEGG   Streptomyces avermitilis: SAVERM_1636
Entry
SAVERM_1636       CDS       T00126                                 

Gene name
gdhA2
Definition
(GenBank) putative NADP-specific glutamate dehydrogenase
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00471  D-Glutamine and D-glutamate metabolism
sma00910  Nitrogen metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SAVERM_1636 (gdhA2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_1636 (gdhA2)
   00220 Arginine biosynthesis
    SAVERM_1636 (gdhA2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAVERM_1636 (gdhA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_1636 (gdhA2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     SAVERM_1636 (gdhA2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SAVERM_1636 (gdhA2)
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 3HCDH_N ThiF 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BAC69347
NITE: SAV1636
UniProt: Q82MM4
Position
2004635..2005813
AA seq 392 aa
MTAPLMTLAWTDHVTGRQGYLVVDRLVRGVSSGGLRMRPGCTLDEVAGLARGMTMKEALH
YNPEGRYIPLGGAKGGIDCDPRSPEAYGLLVRYLRAMRPYIESCWTTGEDLGLTQDLVDR
AAAEAGLVSSIQAVYPLLDDEATARKRLADAFAVEVDGIGLDELVGGCGVAESLLAALDR
AAVPYAGTRVAVQGLGTMGGATARFLARAGLTIVAVADVKGTIANPEGLDVEALLAARDA
YGTVDRSALRPGDRELPGEAWLSVEAEVLVPAAVSYVVDTTNQRRIGARWIVEAANMPVL
PEAEALLTERGITVLPDVVVNSGTNAWWWWTLFGDIDADADEAFARTRRSMRALTDLMLA
RAEADGTTPRAAAHAIVADRLPVIAERFGWYR
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaccgcccccttgatgacgctcgcgtggaccgaccacgtcaccggacggcaggggtac
ctcgtcgtggaccgcctcgtgcggggagtctccagcggcggactgcggatgcgcccgggc
tgcaccctggacgaggtcgccgggctcgcccgcggcatgaccatgaaggaggccctgcat
tacaaccccgagggccgctacatccccctgggcggcgccaagggcggtatcgactgcgat
ccgcgctcgccggaggcgtacggcctgctcgtgcgctatctgcgcgccatgcggccgtac
atcgagagctgctggaccaccggcgaggacctcggcctcacccaggacctcgtcgaccgg
gccgcggccgaggcggggctcgtctcgtccattcaggccgtgtatcccctgctcgacgac
gaggccacggcgcgcaagcggctcgcggacgccttcgcggtcgaggtggacgggatcggg
ctcgacgagctggtcggcgggtgcggggtcgccgagtccctgctggccgccctggaccgg
gccgccgtgccgtacgcgggtacgcgggtcgccgtgcagggactgggcaccatgggcggg
gcgaccgcgcggttcctcgcgcgcgcggggctcacgatcgtcgccgtcgccgacgtcaag
ggcacgatcgcgaaccccgagggcctcgacgtcgaggcgctgctcgcggcccgcgacgcg
tacgggacggtcgaccgctccgcgctgcgccccggcgaccgggagctgccgggcgaggcc
tggctgtccgtcgaagccgaggtgctggtgccggcggccgtgtcgtacgtcgtcgacacc
acgaaccagcggcggatcggcgcccggtggatcgtcgaggcggccaacatgcccgtactg
cccgaagcggaggcactgctcaccgaacgcgggatcaccgtactgcccgacgtcgtcgtc
aactccgggacgaacgcatggtggtggtggaccctgttcggcgacatcgacgccgacgcg
gacgaggcgttcgcccgcacgcgccgttccatgcgcgcgctgaccgacctgatgctggcc
cgcgcggaggccgacggaacgacaccgcgcgccgccgcgcacgcgatcgtcgccgaccgg
ctgccggtgatcgcggaacggttcgggtggtaccgctga

DBGET integrated database retrieval system