KEGG   Streptomyces avermitilis: SAVERM_1645
Entry
SAVERM_1645       CDS       T00126                                 

Definition
(GenBank) putative aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_1645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_1645
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     SAVERM_1645
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class III
   SAVERM_1645
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: BAC69356
NITE: SAV1645
UniProt: Q82ML5
Position
complement(2014006..2015436)
AA seq 476 aa
MTIPSGKAPSEGAPSGNREFDLGALLAERGAERYELHAKYLNHQLPRMLHTIGFDKVYER
AEGAHFWDADGKDYLDMLAGFGVMGLGRHHPVVRKALHDVLDASLADLTRFDCQPLPGLL
AEKLLTHSPHLDRVFFGNSGTEAVETALKFARYATGKPRILYCSHAFHGLTTGSLSVNGE
DGFRDGFAPLLPDTAVPLGDLDALARELKKGDVAALIVEPIQGKGVHEAPPGHLRAAQDL
LQRHKALLIADEVQTGLGRTGDFYAYQHEEGVEPDLVCVAKALSGGYVPVGATLGKEWIF
KKVYSSMDRVLVHSASFGSNAQAMAAGLAVLSVMENEQIVANARATGEQLKSRLAALVDT
YELLSDVRGRGLMIGIEFGRPTSLKLRSRWTVLQAARKGLFAQMVVVPLLQRHRILTQVS
GDHLEVIKLIPPLIIDERDVDRFVAAFTAVMDDAHSGGGLLWDFGKTLVKQAVAQR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaccatcccctcagggaaggcgccgtcggagggggccccttccggaaaccgggagttc
gacctcggcgccctgctggccgagcgcggcgccgagcgctacgaactgcacgccaagtac
ctcaatcaccagctcccgcgcatgctgcacaccatcggcttcgacaaggtgtacgagcgg
gccgaaggggcgcacttctgggacgcggacggcaaggactacctggacatgctcgccggg
ttcggggtgatgggcctgggccgccatcaccccgtcgtccgcaaggcgctgcacgacgtc
ctggacgcctcgctcgccgacctcacccgcttcgactgccagccactgcccggactgctg
gcggagaagctgctcacgcacagcccgcacctcgaccgcgtgttcttcggcaacagcggc
acggaggcggtcgagaccgcgctgaagttcgcccggtacgccaccgggaagccgcggatc
ctgtactgctcgcacgccttccacgggctgaccaccggctcgctgtccgtgaacggcgag
gacggcttccgcgacggcttcgccccgctgctgcccgacaccgccgtcccactcggcgat
ctcgacgccctggcgagggagctgaagaagggcgacgtcgccgccctgatcgtcgaaccg
atccagggcaagggcgtccacgaggccccgcccggacatctgcgcgccgcccaggacctg
ctgcagaggcacaaggcgctgctcatcgccgacgaggtgcagaccggcctcgggcgcacc
ggcgacttctacgcctaccagcacgaggagggcgtggagcccgacctggtctgtgtggcc
aaggcgctgtcgggcggctatgtgccggtcggcgccaccctgggcaaggaatggatcttc
aagaaggtctattcgtcgatggaccgcgtccttgtccactcggcgagcttcggctccaac
gcgcaggccatggcggcgggcctcgccgtgctctccgtcatggagaacgagcagatcgtc
gcgaacgcccgcgcgaccggagaacagctcaagtcccggctcgcggcgctcgtcgacacg
tacgagctgctcagtgacgtacggggccggggtctgatgatcggcatcgagttcgggcgg
cccacgtcgctgaagctgcgcagccgctggaccgtgctgcaggccgcccggaagggtctg
ttcgcgcagatggtcgtcgtcccgctgctgcaacgccaccggatcctcacccaggtctcc
ggcgaccacctggaggtgatcaagctgattccgccgctgatcatcgacgagcgggacgtg
gaccggttcgtggccgccttcaccgccgtgatggacgacgcgcacagcggcggcggcctg
ctgtgggacttcgggaagacgctggtcaagcaggctgttgcccagaggtag

KEGG   Streptomyces avermitilis: SAVERM_3420
Entry
SAVERM_3420       CDS       T00126                                 

Gene name
rocD1
Definition
(GenBank) putative ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_3420 (rocD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_3420 (rocD1)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     SAVERM_3420 (rocD1)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class III
   SAVERM_3420 (rocD1)
SSDB
Motif
Pfam: Aminotran_3 OAM_dimer
Other DBs
NCBI-ProteinID: BAC71132
NITE: SAV3420
UniProt: Q82HT8
Position
4242088..4243341
AA seq 417 aa
MGRGVTRRRAVGNGVLVSTTETLIASADAHSAHTYHPLPVVVATADGAWMTDVEGRRYLD
LLAGYSALNFGHGHRRLIDAARAQLERVTLTSRAFHHDRFAAFCTQLAELCGMEMVLPMN
TGAEAVETAVKTARKWGYRVKGVPAEMAKIVVAGNNFHGRTTTIISFSTDPEARADFGPY
TPGFEIVPYGDLTAMRSALTENTVAVLLEPIQGEAGVLVPPAGYLAGVRELTRDRNVLFV
ADEIQSGLGRTGRTFACEHEGVVPDVYVLGKALGGGIVPVSAVVASSEVLGVFRPGEHGA
TFGGNPLACAVALEVIAMLRSGEYQARAAELGEHLHRELGVLAGTGRVTAVRGRGLWAGV
DVDPAYGTGREISEKLMDRGVLVKDTHGSTIRIAPPLVISKEDLDWGLAQLRGVLGV
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggggaggggggtcacccgtcgtcgtgcggtcggaaacggagtcctcgtgagcaccacc
gaaacactcatcgcctcggccgacgcgcacagtgcgcacacctaccacccgctgccggtc
gtcgtggcgacggcggacggggcctggatgacggacgtcgaggggcgccgctatctcgac
ctgctggccggatactcggcgctcaatttcggacacggccaccggcggctgatcgacgcg
gcgcgagcgcagctggagcgggtgacgctgacgtcgcgggcgttccaccacgaccggttc
gccgccttctgcacccagttggcagagctgtgcggcatggagatggtgctgccgatgaac
acgggcgcggaggcggtcgagacggccgtgaagacggcccggaagtggggctaccgggtg
aagggcgtgcccgcggagatggcgaagatcgtcgtggcgggcaacaacttccacggccgt
acgacgacgatcatcagcttctccacggatccggaggcgcgggcggacttcggtccgtac
acaccgggcttcgagatcgtgccgtacggggatctgaccgcgatgcgttcggcgctcacc
gagaacacggtggcggtgctgctcgagccgatccagggcgaggcgggggtgctggtgccg
ccggccggctacctggccggggtgcgggagctgacgcgggaccggaacgtcctgttcgtc
gcggacgagatccagtcggggctcggccggacggggcgtacgttcgcctgtgagcacgag
ggggtcgtaccggatgtgtacgtcctggggaaggcgctcggcggcgggatcgtgccggtc
tcggcggtggtggcgtcgagcgaggtgctcggtgtgttccggcccggtgagcacggggcg
acgttcggcggcaacccgctggcctgcgcggtggcgctggaggtgatcgcgatgctgcgg
tcgggcgagtaccaggcgcgggcggccgagctgggcgagcacctgcaccgggagctgggg
gtgctggccggcaccgggcgggtgacggcggtgcgcgggcgcgggctgtgggcgggcgtg
gacgtcgatccggcgtacggcacgggccgggagatctccgagaagctgatggaccggggt
gtcctggtcaaggacacccacggctcgacgatccggatcgcgcccccactggtgatctcc
aaggaggacctggactgggggctggcccaactgcgtggcgtgctcggtgtctag

KEGG   Streptomyces avermitilis: SAVERM_7112
Entry
SAVERM_7112       CDS       T00126                                 

Gene name
rocD2
Definition
(GenBank) putative ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_7112 (rocD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_7112 (rocD2)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     SAVERM_7112 (rocD2)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class III
   SAVERM_7112 (rocD2)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: BAC74823
NITE: SAV7112
UniProt: Q826R3
Position
complement(8471639..8472865)
AA seq 408 aa
MTAPARTRSSADLIRAEAPVLAHNYHPLPVVVARAEGTWVEDVEGRRYLDMLAGYSALNF
GHRHPVLIEAAHRQLDQLTLTSRAFHNDRLAQFAESLAELTGLDMVLPMNTGAEAVESAI
KVARKWAYEVKGVAPDQATIVVAADNFHGRTTTIVSFSTDDTARTGFGPFTPGFRIVPYN
DLAALEAAVDETTAAVLIEPIQGEAGVVIPDDGYLAGVRELTRRTGCLFIADEIQSGLGR
TGRTLAVEHESVVPDMLLLGKALGGGIVPVSAVVARRDVLAVLRPGEHGSTFGGNPLAAA
VGSAVVGLLETGEFQRGAAELGVVLRDGLAALVGKGVVGFRARGLWAGVDIDPAIGTGRE
ISERLMREGILVKDTHGSTIRLAPPLTITGEELASALGTLEKVLTQEA
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaccgctcccgcccgtacgcgttcgtccgccgacctgatccgtgccgaggcgccggtc
ctcgcgcacaactaccacccgctgcccgtggtcgtggccagggccgagggcacctgggtg
gaggacgtcgagggccgccgctatctcgacatgctggcgggctactcggccctgaacttc
ggccaccgtcacccggtgctgatcgaggccgcacaccgccagctcgaccagctgaccctg
acctcccgcgccttccacaacgaccgactggcccaattcgccgagtccctggccgagttg
acgggcctggacatggtgctgccgatgaacacgggcgccgaggcggtggagagcgccatc
aaggtggcccgcaaatgggcgtacgaggtgaagggcgtcgccccggaccaggcgacgatc
gtcgtggccgccgacaacttccacggccgtacgacgacgatcgtcagcttctccacggac
gacaccgcccgtacggggttcggccccttcacgccgggcttccggatcgtcccgtacaac
gacctggccgcgctcgaggccgccgtggacgagacgacggcggccgtgctgatcgagccg
atccagggcgaggctggcgtcgtcatcccggacgacggctatctggccggcgtacgcgag
ctcacccgccgcaccgggtgtctgttcatcgcggacgagatccagtcgggcctcgggcgc
accggccgcacgctggccgtggagcacgagagtgtcgtcccggacatgctgctgctcggc
aaggcgctcggcggcggcatcgtgccggtgtccgcggtggtcgcccgccgggacgtcctc
gcggtactgcggcccggggagcacggctcgacgttcggcggcaatccgctggccgccgcg
gtcggctcggcggtggtcgggctgctggagaccggtgaattccagcgcggggcggccgag
ctgggtgtggtgctgcgggacggactcgccgccctcgtcggcaagggcgtcgtgggcttc
cgggcgcgcgggctgtgggcgggcgtcgacatcgaccccgcgatcggcaccgggcgcgag
atcagcgaacgcctcatgcgcgaggggatcctggtcaaggacacccacggttcgacgatc
cggctggccccgccgctcacgatcaccggcgaggaactggcgtcggctctggggaccctg
gagaaggtgttgacgcaagaggcctga

DBGET integrated database retrieval system