KEGG   Streptomyces avermitilis: SAVERM_1646Help
Entry
SAVERM_1646       CDS       T00126                                 

Gene name
dxs1
Definition
(GenBank) putative 1-deoxy-D-xylulose 5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma00730  Thiamine metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAVERM_1646 (dxs1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_1646 (dxs1)
Enzymes [BR:sma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     SAVERM_1646 (dxs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAC69357
NITE: SAV1646
UniProt: Q82ML4
Position
complement(2015433..2017331)
Genome map
AA seq 632 aa AA seqDB search
MTMLENIRGPRDLKALSEAELGELAEEIREFLVHAVARTGGHLGPNLGVVELSVALHRAF
ESPVDRILWDTGHQSYVHKLLTGRQDFSKLRSKGGLSGYPSREESEHDVIENSHASTVLG
WADGLAKARQVQGEKGHVVAVIGDGALTGGMAWEALNNIAAAKDRPLIIVVNDNERSYSP
TIGGLANHLATLRTTDSYEKVLAWGKDVLLRTPVVGNTLYESLHGAKKGFKDAFAPQGMF
EDLGLKYVGPIDGHDMKAMESAFRRAKRFHGPVLIHCLTEKGRGYEPALAHDEDRFHTVG
VMDPLTCEPLAPSNGPSWTSVFGDEIVRIGEEREDVVAITAAMLHPVGLNKFAEKFPGRV
WDVGIAEQHAAVSAAGLATGGLHPVVAVYATFLNRAFDQLLMDVALHRCGVTFVLDRAGV
TGVDGASHNGMWDMSILQVVPGLRIAAPRDADQLRAQLREAVAVDDAPTLLRFPKESVGP
AIPAVDHVGGMDVLHRFPESPQVLLVAVGVMAPVCLQAAELLEARGIGCTVVDPRWVKPV
DPSLPGLAAEHRLVAVVEDNSRAAGVGAAVALALSDAEVDVPVRRFGIPEQFLAHAKRAE
VLADIGLTPVEIAGRISAGLATKEELSKEKQE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatgctggagaacatccggggaccacgcgacctgaaggcgctgtccgaggcggaa
ctcggtgaactggccgaagagatacgggagttcctggtgcatgcggtcgccaggacagga
ggccatctggggcccaatctgggggtggtggaactctccgtcgcactgcaccgggccttc
gagtcaccggtcgaccgcatcctgtgggacaccggccaccagagctatgtgcacaagctt
ctgactgggcggcaggacttttccaagctgcgcagcaagggcggcctgtccggctatccc
tcgcgcgaggagtccgagcacgacgtcatcgagaacagccacgcgtcgaccgtgctcggc
tgggcggacgggctcgccaaggcccgccaggtgcagggcgagaaggggcatgtcgtcgcg
gtcataggcgacggcgcgctgaccggcggcatggcctgggaggcgctgaacaacatcgcc
gccgccaaggaccgcccgctgatcatcgtcgtcaacgacaacgaacgttcgtactcgccc
accatcggcggcctcgccaaccacctcgccacgctccgcaccaccgacagctacgagaag
gtgctggcctggggcaaggacgtactgctgcgcacgccggtcgtcggcaacaccctctac
gagtcgctgcacggcgcgaagaaggggttcaaggacgcgttcgcgccgcagggcatgttc
gaggacctggggctgaagtacgtagggccgatcgacgggcacgacatgaaggcgatggaa
tcggcgttcagacgcgcgaaacgtttccacgggccggtgctcatccactgcctgacggag
aagggccggggatacgagcccgcgctcgcccacgacgaggaccgtttccacaccgtcggc
gtgatggaccccctcacctgcgagcccctcgccccctccaacggcccttcctggacctcg
gtgttcggtgacgagatcgtccggatcggcgaggagcgcgaggacgtcgtggcgatcacg
gcggccatgctgcacccggtggggctgaacaagttcgcggagaagttccccggccgggtc
tgggacgtcgggatcgccgagcagcacgcggcggtgtcggcggcaggtctcgccacgggc
gggctgcatccggtcgtagcggtgtacgcgaccttcctcaaccgcgccttcgaccagctg
ttgatggatgtcgcgctgcaccgctgcggggtgaccttcgtgctggaccgggccggggtc
accggcgtcgacggcgcctcccacaacggcatgtgggacatgtcgatcctccaggtggtg
cccggcctcaggatcgccgcaccgcgcgacgccgaccagctgcgggcccagctgcgggag
gcggtggcggtcgacgacgcgccgacgctgctgcgtttcccgaaggagtccgtggggccc
gcgatcccggcggtcgaccatgtgggcggcatggacgtactgcaccgctttcccgagtct
ccgcaggtcctgctggtcgccgtcggtgtcatggccccggtctgcctccaggccgccgaa
ctgctcgaggcgcggggcatcggctgcacggtcgtcgacccgcgctgggtcaagcccgtc
gacccttcgctgccggggctggccgccgagcaccggctggtcgcggtcgtcgaggacaac
agccgggcggccggcgtcggcgccgcggtcgcgctggccctctcggacgccgaagtcgac
gtgccggtacggcggttcggtatcccggagcagttcctcgcgcacgccaagcgcgccgag
gtgctggccgacataggcctgacgcccgtcgagatcgccgggcggatcagcgcggggctg
gccaccaaggaagagctgtccaaggagaaacaggaatga

KEGG   Streptomyces avermitilis: SAVERM_2244Help
Entry
SAVERM_2244       CDS       T00126                                 

Gene name
dxs2
Definition
(GenBank) putative 1-deoxy-D-xylulose 5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma00730  Thiamine metabolism
sma00900  Terpenoid backbone biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAVERM_2244 (dxs2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_2244 (dxs2)
Enzymes [BR:sma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     SAVERM_2244 (dxs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh NTP_transf_3 PFOR_II
Motif
Other DBs
NCBI-ProteinID: BAC69955
NITE: SAV2244
UniProt: Q82KW8
Position
complement(2730469..2732397)
Genome map
AA seq 642 aa AA seqDB search
MPLLTRIRGPRDLDRLSLEQLDQLAEEIRTFLVDAVSKTGGHLGPNLGVVELTIALHRVF
DSPKDRVLFDTGHQSYVHKLLTGRQDFSKLKMKGGLSGYPSQAESEHDVIENSHASTVLG
WADGLAKANQVLERDDHVVAVIGDGALTGGMAWEALNNIAAAKDRPLVIVVNDNERSYAP
TIGGLANHLATLRTTDGYERFLARGKDLLERTPVVGRPLYETLHGAKKGLKDFIAPQGMF
EDLGLKYVGPIDGHDIEALESALARAKRFGGPVIVHCLTEKGRGYQPALQDEADRFHAVG
KIHPDTGLPIASSGADWTSVFGEEMVKLGQERKDIVAITAAMLQPVGLDKFAKVFPKRVY
DVGIAEQHAAVSAAGLATGGLHPVFAVYATFLNRAFDQVLMDVALHKCGVTFVLDRAGVT
GTDGASHNGMWDMSILQVVPGLRLAAPRDADQVRAQLREAVDVDDAPTVVRFSKGAVGPA
VPAVGRIGGMDVLREPGTDAPDVLLVSVGALAPMCLEIAGLLDKQGISATVVDPRWVKPV
DEAMAPLAERHRVVVTVEDNSRVGGVGSAIAQALRDAGVDVPLRDFGIPPRFLDHASRGE
VMAEIGLTAPDIARQVTGLVSKLDGRFERPTAEIDSVEPARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgctgacccgcatcaggggaccgcgcgatctggaccggctcagcctggagcag
ctggaccagctggcagaggagatccggaccttcctcgtcgacgccgtctccaagaccggc
ggccacctcggccccaacctcggcgtggtcgagctcaccatcgccctgcaccgcgtcttc
gactcgcccaaggaccgggtgctcttcgacaccgggcaccagtcctacgtccacaagctg
ctcaccggccgtcaggacttctccaagttgaagatgaagggcggcctgtccggctacccc
tcgcaggccgagtccgagcacgacgtcatcgagaactcgcacgcctccacggtcctcggc
tgggccgacggcctcgccaaggccaaccaggtgctcgaacgcgacgaccacgtggtcgcg
gtcatcggcgacggcgccctcaccggcggcatggcctgggaggcgctgaacaacatcgcg
gccgccaaggaccgccccctcgtcatcgtcgtgaacgacaacgagcgctcgtacgccccc
acgatcggcggcctcgccaaccacctggccaccctgcgcaccacggacggctacgagcgc
ttcctggcccgcggcaaggacctcctggagcgcacgccggtcgtcggcaggccgctctac
gagaccctgcacggcgccaagaagggcctcaaggacttcatcgccccgcagggcatgttc
gaggacctcggcctcaagtacgtcgggccgatcgacggccacgacatcgaggccctggag
tccgcgctcgcccgcgccaagcgcttcggcggcccggtcatcgtgcactgcctcaccgag
aagggccgcggctaccagcccgccctccaggacgaggccgaccgcttccacgccgtcggc
aagatccaccccgacacgggcctgccgatcgcctcctccggcgccgactggacctccgtg
ttcggcgaggagatggtcaagctcggccaggagcgcaaggacatcgtcgccatcacggcc
gcgatgctccagccggtcggcctcgacaagttcgccaaggtcttcccgaagcgggtgtac
gacgtcggcatcgccgagcagcacgccgccgtctccgcggccggcctggccaccggcgga
ctgcaccccgtcttcgccgtctacgccaccttcctcaaccgcgccttcgaccaggtcctg
atggacgtggccctgcacaagtgcggtgtcaccttcgtcctggaccgcgcgggcgtcacc
ggcaccgacggcgcctcgcacaacggcatgtgggacatgtccatcctccaggtcgtgccg
ggcctgcgcctggccgcgccgcgtgacgccgaccaggtccgcgcccagctgcgcgaggcc
gtcgacgtcgacgacgcgccgaccgtggtccgcttctccaagggcgcggtcggcccggcc
gtccccgccgtgggccggatcggcggcatggacgtcctgcgcgagcccggcaccgacgcc
ccggacgtgctcctcgtctccgtcggcgccctcgcgcccatgtgcctggagatcgccggc
ctcctcgacaagcagggcatctccgcgaccgtcgtcgacccgcgctgggtcaagcccgtc
gacgaggccatggccccgctcgccgagcggcaccgcgtggtcgtcaccgtcgaggacaac
tcccgcgtcggcggcgtcggctcggcgatcgcgcaggccctgcgcgacgcgggcgtggac
gtaccgctgcgcgacttcggcatcccgccgcgcttcctcgaccacgcctcccggggcgag
gtcatggcggagatcggcctgaccgcgccggacatcgcccgccaggtcaccgggctcgtc
tccaagctcgacggccgcttcgagcgcccgacggcggagatcgactcggtggagcccgcg
cgcgactga

DBGET integrated database retrieval system