KEGG   Streptomyces avermitilis: SAVERM_1672
Entry
SAVERM_1672       CDS       T00126                                 

Gene name
dao
Definition
(GenBank) putative D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00311  Penicillin and cephalosporin biosynthesis
sma00330  Arginine and proline metabolism
sma00472  D-Arginine and D-ornithine metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_1672 (dao)
   00330 Arginine and proline metabolism
    SAVERM_1672 (dao)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    SAVERM_1672 (dao)
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SAVERM_1672 (dao)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     SAVERM_1672 (dao)
SSDB
Motif
Pfam: DAO FAD_binding_2 Pyr_redox FAD_binding_3 NAD_binding_8 NAD_Gly3P_dh_N Pyr_redox_2 NAD_binding_7 FAD_oxidored HI0933_like 3HCDH_N ApbA UDPG_MGDP_dh_N GIDA Pyr_redox_3 Thi4 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: BAC69383
NITE: SAV1672
UniProt: Q82MI8
Position
2046352..2047305
AA seq 317 aa
METGRSGEVIVVGGGVIGLTTAIVLAESGRRVRVWTREPVERTTSAVAGALWWPYRIEPA
ASARAWALTSFDVYEELATRPGRTGVRMVEGVQGGATLEETEAWALGRALGLRAATAEEC
PGGGLWARLPLIDMPAHLRWLRERFTAAGGTVETRTVTDLAEAKAPVVVNCTGLGARDLV
PDTSVRPVRGQLVVVENPGIRTWLVSTGADGEMAYFFPQPGRLLLGGTAVEDEWSLVPDP
AVAEAIVRRCAAWRPEIAGARVLEHRTGLRPARGTVRLEREPLSDGRVLVHNYGHGGAGV
TVAWGCAQEAAGLAASW
NT seq 954 nt   +upstreamnt  +downstreamnt
gtggagactggtcgaagcggtgaggtcatcgtggtcggcggcggcgtcatagggctgacg
acggcgatcgtcctggcggagagcggccggcgcgtacgcgtgtggacgcgggagccggtc
gagcggaccacctcggcggtggcgggcgcgctgtggtggccgtatcggatcgagccggcg
gcgtcggcccgcgcgtgggccctcacctcgttcgatgtgtacgaggaactggcgacacgc
cccgggcgaaccggtgtacgcatggtcgaaggcgtgcagggcggggcgacgctggaggag
accgaggcgtgggcattgggccgggccctcgggctgcgggcggcgacggccgaggagtgt
cccgggggcgggctgtgggcacggctgccgctgatcgacatgccggcgcatctgcggtgg
ctgcgcgagcggttcaccgcggcgggcgggacggtcgagacccgtacggtgaccgacctc
gcggaggccaaggcgccggtcgtggtcaactgcacgggcctgggcgcccgtgacctcgta
ccggacacgtcggtgcgtcccgtgcgggggcagctcgtcgtcgtggagaaccccggcatc
cgcacctggctcgtctccaccggggccgacggggagatggcgtacttcttcccgcagccg
ggccggcttctgctcggcggcacggcggtcgaggacgagtggtccctcgtgcccgatccg
gcggtggccgaggcgatcgtgcggcgctgtgcggcgtggcgacccgagatcgccggggcg
cgggtcctggagcaccggacggggctgcggccggcgcgcggcacggtccggctggaacgc
gaaccgctctcggacggacgggtgttggtgcacaactacggccacggcggcgcgggcgtc
accgtggcctgggggtgcgcccaggaggcggcagggctggccgcctcctggtga

DBGET integrated database retrieval system