KEGG   Streptomyces avermitilis: SAVERM_1680Help
Entry
SAVERM_1680       CDS       T00126                                 

Gene name
fadB1
Definition
(GenBank) putative fatty acid oxidation complex alpha-subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_1680 (fadB1)
   00650 Butanoate metabolism
    SAVERM_1680 (fadB1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1680 (fadB1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1680 (fadB1)
   00310 Lysine degradation
    SAVERM_1680 (fadB1)
   00380 Tryptophan metabolism
    SAVERM_1680 (fadB1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_1680 (fadB1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_1680 (fadB1)
   00281 Geraniol degradation
    SAVERM_1680 (fadB1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1680 (fadB1)
   00930 Caprolactam degradation
    SAVERM_1680 (fadB1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SAVERM_1680 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_1680 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SAVERM_1680 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored NAD_Gly3P_dh_N ApbA NAD_binding_8 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAC69391
NITE: SAV1680
UniProt: Q82MI0
Position
complement(2056428..2058635)
Genome map
AA seq 735 aa AA seqDB search
MSTEPTTIRWEQDETGIVTLVLDDPNQSANTMNQAFRASIAAIADRAEAEKDSIRGIIYT
SAKKTFFAGGDLKDMMKAGPSDAQRAFETGTAIKNSLRRIETLGKPVVAAINGAALGGGY
EIALASHHRIALDAPGSKIGLPEVTLGLLPAGGGVTRTVRLMGIADALLKVLLQGTQYAP
ARALENGLVHEVAATHEEMLAGARAFIDANPESQQPWDKPGYRIPGGTPANPKFAANLPA
FPANLKKQLNGAPYPAPRNILAAAVEGSQVDFETALVIEARYFTELVTGQTAKNMIQAFF
FDLQAVNSGANRPQGVAPRQVRKVAVLGAGMMGAGIAYSCARAGIEVVLKDVSAEAAAKG
RGYSEKLCAKAVSRGRTTQEKADALLARITPTADPADLAGCDAVIEAVFEDTALKHKVFE
EIEHIVEPDALLCSNTSTLPITALAEGVERQADFIGLHFFSPVDKMPLVEIIKGERTGDE
ALARAFDLVRQINKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASIEQAAAQAGY
PAKVLSLMDELTLTLPRKIRAESKRAVEEAGGTWVTHPAEAVIDRMVDEFGRTGRGGGAG
FYDYVDGKRAKLWPGLREHFTKPGHEIPFEDMQERMLFAEALDTVRLLEEGVLTSVADAN
IGSIFGIGFPGWTGGVLQYINGYAGGPGAGAGAGAGLPGFVARARELAERYGERFTPPAL
LVEKAEKGEHFSDAK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgagcccaccaccatccgctgggaacaggacgagaccgggatcgtcaccctc
gttctcgacgaccccaaccagtccgccaacaccatgaaccaggccttcagggcgtcgatc
gcggcgatcgccgaccgcgccgaggccgagaaggactccatccgcgggatcatctacacc
tccgccaagaagaccttcttcgcgggcggcgacctcaaggacatgatgaaggccggcccg
tcggacgcccagcgggcgttcgagaccggtacggcgatcaagaactccctgcgccgcatc
gagaccctgggcaagccggtggtcgccgccatcaacggcgcggccctcggcggcggttac
gagatcgctctcgcctcccaccaccgcatcgccctcgacgcgcccggctccaagatcggc
ctgcccgaggtcaccctcggtctgctcccggcgggcggcggcgtcacccgtaccgtacgc
ctcatgggcatcgccgacgccctcctgaaggtgctcctccagggcacccagtacgcgccc
gcccgcgccctcgagaacggcctcgtccacgaagtcgccgcgacccacgaggagatgctc
gcgggggcccgcgccttcatcgacgccaaccccgagtcccagcagccctgggacaagccg
ggctaccgcatcccgggcggtacccccgccaacccgaagttcgcggcgaacctgccggcc
ttcccggccaacctgaagaagcagctgaacggcgccccctacccggccccgcgcaacatc
ctcgcggccgccgtcgagggctcccaggtcgacttcgagaccgccctggtgatcgaggcc
cgctacttcaccgagctggtcaccggacagaccgccaagaacatgatccaggcgttcttc
ttcgacctccaggccgtcaactccggcgccaaccgcccccagggcgtcgcaccgcgccag
gtccgcaaggtcgccgtactcggcgccgggatgatgggcgcgggcatcgcctactcatgt
gcccgcgcgggcatcgaggtcgtcctcaaggacgtgtccgcggaggccgcggccaagggc
aggggctactccgagaagctgtgcgccaaggcggtctcccggggacgtacgactcaggag
aaggcggacgcgctcctcgcccgcatcacgcccaccgccgaccctgccgacctggcgggc
tgcgacgcggtgatcgaggccgtcttcgaggacacggcgctcaagcacaaggtgttcgag
gagatcgagcacatcgtcgagccggacgccctgctctgctccaacacctccaccctgccc
atcaccgcactcgccgagggcgtggagcgccaggccgacttcatcgggctgcacttcttc
tcgcccgtcgacaagatgccgctcgtcgagatcatcaagggcgagcggaccggcgacgag
gcgctggcgcgcgccttcgacctggtccgccagatcaacaagaccccgatcgtcgtcaac
gactcgcgcggcttcttcacctcccgtgtcatcggccacttcatcaacgagggcgtggcg
atggtcggtgagggcatcgagcccgcgtccatcgagcaggcggccgcgcaggcgggctat
ccggccaaggtcctgtccctcatggacgagttgacgctcaccctgccgcgcaagatccgg
gccgagtcgaagcgggcggtcgaggaggcgggcggcacgtgggtgacccacccggcggag
gcggtcatcgaccgcatggtcgacgagttcggccgcacgggacgcggcggcggtgcgggc
ttctacgactacgtggacggcaagcgcgccaagctgtggcccgggctgcgcgagcacttc
accaagccgggccatgagatccccttcgaggacatgcaggagcgcatgctcttcgccgag
gcgctggacaccgtccggctcctcgaggagggcgtgctgacgtccgtcgcggacgccaat
atcgggtcgatcttcgggatcggtttcccgggctggaccggcggtgtcctccagtacatc
aacgggtacgccggcgggccgggtgccggcgccggggcaggtgccggcctgcccggcttc
gtggcacgggcgcgtgaactcgccgagcgctacggggagcggttcacgccgccggccctg
ctcgtggagaaggcggagaagggcgagcacttcagcgacgcgaagtag

DBGET integrated database retrieval system