KEGG   Streptomyces avermitilis: SAVERM_1703
Entry
SAVERM_1703       CDS       T00126                                 

Gene name
pcaH
Definition
(GenBank) putative protocatechuate 3,4-dioxygenase beta subunit
  KO
K00449  protocatechuate 3,4-dioxygenase, beta subunit [EC:1.13.11.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1703 (pcaH)
   00624 Polycyclic aromatic hydrocarbon degradation
    SAVERM_1703 (pcaH)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.3  protocatechuate 3,4-dioxygenase
     SAVERM_1703 (pcaH)
SSDB
Motif
Pfam: Dioxygenase_C PCDO_beta_N CarboxypepD_reg Glyoxalase_6 SdrD_B DUF4198
Other DBs
NCBI-ProteinID: BAC69414
NITE: SAV1703
UniProt: Q82MF7
Position
2080504..2081274
AA seq 256 aa
MALTQSHIDIEVDDLQNAYDKAVAEGGPVRHHPPRDYAPYRSSVLRHPKQPLVAVHGGDP
ETVELAGPVFGVTDITEIDNDLTRQHRGEPIGERMTVSGRLLDRDGRPVRGQLVEVWQAN
AAGRYAHLREQHPAPLDPNFTGVGRTLTDDQGRYTFTTIKPGPYPWGNHTNAWRPAHIHF
SVFGTAFTQRLVTQMYFPSDPLFAYDPILRSVTDAAARNRLIATYQHDLSAPGFSLGYAW
DIVLDGPSATWIEEGR
NT seq 771 nt   +upstreamnt  +downstreamnt
atggctctcactcagtcgcacatcgacatagaggtcgacgacctccagaacgcgtacgac
aaggcggtcgccgagggcggcccggtccgccaccacccgccgcgcgactacgccccgtac
cgcagttccgtgctgcgtcaccccaagcagccgctggtcgccgtgcacggcggggacccg
gagacggtggagctggcgggtccggtcttcggcgtcaccgacatcaccgagatcgacaac
gacctgacccgccagcaccggggcgagccgatcggcgaacgcatgaccgtctcgggccgg
ctcctcgaccgcgacggccgacccgtgcggggccagctggtcgaggtctggcaggccaac
gcggccggccgctacgcccatctgcgcgagcagcacccggcgccgctcgaccccaacttc
accggcgtggggcggaccctgacggatgatcagggccggtacacgttcaccaccatcaag
ccgggcccgtacccgtggggcaaccacaccaacgcgtggcggcccgcgcacatccacttc
tcggtcttcggcacggcgttcacccagcggctcgtgacacagatgtacttcccgagcgac
ccgctgttcgcatacgacccgatcctgcggtccgtgacggacgcggcggcccgaaaccgt
ctgatcgccacctaccagcacgacctctcggcgcccgggttctccctcggctacgcatgg
gacatcgtcctcgacggtccctccgccacctggatcgaggaaggccgttga

KEGG   Streptomyces avermitilis: SAVERM_1704
Entry
SAVERM_1704       CDS       T00126                                 

Gene name
pcaG
Definition
(GenBank) putative protocatechuate 3,4-dioxygenase alpha subunit
  KO
K00448  protocatechuate 3,4-dioxygenase, alpha subunit [EC:1.13.11.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1704 (pcaG)
   00624 Polycyclic aromatic hydrocarbon degradation
    SAVERM_1704 (pcaG)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.3  protocatechuate 3,4-dioxygenase
     SAVERM_1704 (pcaG)
SSDB
Motif
Pfam: Dioxygenase_C CarboxypepD_reg
Other DBs
NCBI-ProteinID: BAC69415
NITE: SAV1704
UniProt: Q82MF6
Position
2081220..2081840
AA seq 206 aa
MGHRPRRSLRHLDRGRPLSMTERLLPTPSHTIGPFYGHALPFPGGPDVAPQGHPDTITLH
GYVFDGAGAPIPDALLDFWQAAPDGSLTGAPGSMRRDPSTGGFLGRNGTDFTGFGRVATD
ADGHYALHTLPPGNAGLPYISVCVFARGLVHHLFTRAYLADGADPLLDSLPAERRATLIA
AEGANRTYRFDIRLQGEGETVFLEFQ
NT seq 621 nt   +upstreamnt  +downstreamnt
atgggacatcgtcctcgacggtccctccgccacctggatcgaggaaggccgttgagcatg
accgagcggttgctccccaccccgtcccacaccatcggccccttctacgggcacgcgctc
cccttccccggtggcccggacgtcgcgccccagggccaccccgacacgatcaccctgcac
ggatacgtgttcgacggtgcgggtgcgccgatccccgacgccctcctggacttctggcag
gcggcgcccgacggctccctgacgggtgcccccggctcgatgcgccgcgacccgtcgacg
ggcggcttcctgggccgcaacggcaccgacttcacgggcttcgggcgggtcgccacggac
gccgacggacactacgcgctgcacaccctgccgccgggcaatgccggactgccgtacatc
agcgtgtgcgtgttcgcgcgcggtctggtgcaccacctgttcacccgcgcctacctcgcc
gacggcgccgacccgctgctcgactcgctgcccgccgagcggcgcgccacgctcatcgcg
gccgagggcgcgaaccgcacgtaccgtttcgacatccgccttcagggcgaaggcgaaacg
gtcttcctggagttccagtga

DBGET integrated database retrieval system