KEGG   Streptomyces avermitilis: SAVERM_1705
Entry
SAVERM_1705       CDS       T00126                                 

Gene name
pcaB
Definition
(GenBank) putative 3-carboxy-cis,cis-muconate cycloisomerase
  KO
K01857  3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1705 (pcaB)
Enzymes [BR:sma01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.2  3-carboxy-cis,cis-muconate cycloisomerase
     SAVERM_1705 (pcaB)
SSDB
Motif
Pfam: Lyase_1 ADSL_C FumaraseC_C
Other DBs
NCBI-ProteinID: BAC69416
NITE: SAV1705
UniProt: Q82MF5
Position
2081837..2083174
AA seq 445 aa
MTEPVDSVDSDAGLLAPGWTGSPASAATGNGAFLQALLDAEAALTRAQAGLGLAPAEAAS
AVSVAADAVGFDVRSIALRARAGGNPVIPMVADLTAAVGAEHGPYVHRGATSQDIMDTAM
MLVARAALDLILADLERTARALGRLAAAHRDTVMPGRTLTQHAVPTTFGLKAAGWRSLVL
DARDRLTTVRLPAQLGGAAGTLAAFNAFGTEDTQALVTAYARELGLAEPALPWHTLRTPI
ADLAGALAFTAGALGKPAADVLTLARTEIAEVTEGAGGGSSAMPHKANPVAATLIAASAR
RAPGLAATLYASMAAEDERPAGAWHAEWEPLRELLRLVGGAAGHAAELAEGLWVNADTMR
EHLGLTQGLIVSERLAAELAPVLGRARAKELVTRAAKLAVAENRPLVDVLGEEQELTDLD
LADLTDPTRYTGSAGALTDRALERR
NT seq 1338 nt   +upstreamnt  +downstreamnt
gtgacagaacccgtcgattccgtcgattccgacgccggcctgctcgcccccgggtggacg
ggatcccccgcgtcggccgccaccgggaacggtgcgtttctccaggcgctgctcgacgcg
gaggcggcgctgacgcgggcccaggcggggctcggcctggccccggccgaggccgcgtcg
gcggtgtcggtggccgccgacgccgtgggcttcgacgtccggtcgatcgcgctgcgcgcc
cgcgccggcggcaatccggtgatcccgatggtagcggatctgacggcggcggtcggcgcg
gagcacgggccgtacgtccaccggggcgcgaccagccaggacatcatggacacggcgatg
atgctggtcgcccgcgccgcactggacctgatcctggcggacctggagcgtacggcgcgg
gcgctgggccgactggccgccgcccaccgggacaccgtgatgccggggcggaccctgaca
cagcatgctgtaccgacgaccttcgggctgaaggcggcgggatggcgctcgctggtgctg
gacgcccgggaccggctcacgaccgtgcggctgccggcccaactgggcggggccgcagga
acgttggcggccttcaacgcgttcgggaccgaggacacccaggccctcgtgaccgcgtac
gcccgtgaactcgggctcgcggaaccggcgttgccgtggcacaccctgcgtacgccgatc
gccgatctggccggagccctggccttcacggccggcgccctcggcaagccggcggcggac
gtcctcaccctcgcccgcacggagatcgccgaggtcaccgagggtgccgggggcgggtcg
tccgccatgccgcacaaggcgaatcccgtcgcggctaccctgatcgccgcctccgcccgg
cgcgcgccagggctcgccgccacgctctacgcgtcgatggccgccgaggacgagcggccc
gccggggcctggcatgccgagtgggagccgctgcgggagctgctccgactggtcggtggg
gccgcgggccatgccgccgaactggcggagggcctttgggtgaacgcggacaccatgcgg
gagcacctcggtctcacccaggggctgatcgtctccgagcggctggccgccgagctcgct
cccgtgctcgggcgggcccgcgccaaggagctggtgacccgggccgcgaagctcgccgtc
gccgagaaccggcctctcgtggacgtgctcggtgaggagcaggagctgacggacctcgat
ctcgcggacctcaccgaccccacccgctacacgggctccgcgggagccctcaccgaccgt
gcgctggagcgacgttga

DBGET integrated database retrieval system