KEGG   Streptomyces avermitilis: SAVERM_1706
Entry
SAVERM_1706       CDS       T00126                                 

Gene name
pcaL1
Definition
(GenBank) putative 3-oxoadipate enol-lactone hydrolase
  KO
K14727  3-oxoadipate enol-lactonase / 4-carboxymuconolactone decarboxylase [EC:3.1.1.24 4.1.1.44]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1706 (pcaL1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.24  3-oxoadipate enol-lactonase
     SAVERM_1706 (pcaL1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     SAVERM_1706 (pcaL1)
SSDB
Motif
Pfam: CMD Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4 Esterase Ndr Esterase_PHB DUF2048 Ser_hydrolase
Other DBs
NCBI-ProteinID: BAC69417
NITE: SAV1706
UniProt: Q82MF4
Position
2083171..2084310
AA seq 379 aa
MTTKPNGRLSHHHAEGPVTAPPLLLGPSLGTSYALWDKVAPELSVTHRVIRWDLPGHGGS
PAGLIGPGATVADLAELVLALAGSLGIDRFAYAGVSLGGAVGLHLAAHHPERVSSLAVLC
SSAHFNGAQPWRERAELVRREGVAPVAATADSRWFTPGFTVPELVQDHRDADPDAYAACC
DALAAFDLRDRLSSITAPTLLVAGRQDPATPPAHLREIADAVPGASLTEIAGASHLAPAE
RPEAVLAALRGHFDGYASRGMEVRRQVLGDEHVDRAQARQTPFTARFQDFISRYAWGEIW
TDSTLTRRERSMITLTALVAHGHYDELALHVRAARRNGLTPEEIGAVLLQTAVYCGVPAA
NSAFAVAQRVLAEEDDTAG
NT seq 1140 nt   +upstreamnt  +downstreamnt
ttgaccaccaaaccgaacggcaggctgtcgcaccaccacgccgagggacccgtcaccgct
cccccgctgctcctcggcccctcgctgggcacgtcgtacgcgctgtgggacaaggtcgcg
cccgagctgtccgtcacgcaccgggtgatccgctgggacctgcccgggcacggcggctcg
ccggccggtctgatcggtccgggggcgaccgtcgccgacctcgccgagctggtgctggcg
ctcgccggctcactgggcatcgaccggttcgcgtacgccggtgtctcgctgggtggagcg
gtcgggctgcacctcgccgcgcaccacccggagcgggtgtcgtccctcgcggtcctctgc
tcgtcggcccacttcaacggcgcgcagccgtggcgggagcgggccgagctggtccgccgg
gagggtgtcgcgccggtcgcggcgacggccgactcccgctggttcacgcccggtttcacc
gtgccggagctcgtccaggaccaccgggacgcggacccggacgcgtacgcggcctgctgt
gacgcgctggccgcgttcgacctccgtgaccggctgtcgtcgatcaccgccccgacgctg
ctggtcgcgggccgtcaggaccccgcgacgccgcccgcgcatctgcgggagatcgcggac
gcggtgcccggcgcctcgctcaccgagatcgcgggcgcctcgcatctcgcgcccgcggag
cgcccggaggccgtgctcgccgcgttgcgcgggcacttcgacgggtatgcgtcgcgcggg
atggaggtacgccgccaggtcctcggcgacgagcacgtggaccgcgcgcaggcacggcag
acccccttcaccgcccgcttccaggacttcatctcgcgctatgcctggggcgagatctgg
accgactccaccctcacgcgccgtgagcgcagcatgatcacgctgacggcgctggtggcg
cacggccactacgacgaactggccctgcatgtgcgggcggcccggcggaacgggctcaca
ccggaggagatcggcgcggtgctgctccagacggcggtgtactgcggggttccggcggcg
aactcggcgttcgcggtggcgcagcgggtgctggccgaggaggacgacacggcggggtga

KEGG   Streptomyces avermitilis: SAVERM_1968
Entry
SAVERM_1968       CDS       T00126                                 

Gene name
pcaL2
Definition
(GenBank) putative 3-oxoadipate enol-lactone hydrolase
  KO
K14727  3-oxoadipate enol-lactonase / 4-carboxymuconolactone decarboxylase [EC:3.1.1.24 4.1.1.44]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_1968 (pcaL2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.24  3-oxoadipate enol-lactonase
     SAVERM_1968 (pcaL2)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     SAVERM_1968 (pcaL2)
SSDB
Motif
Pfam: CMD Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4 Esterase_PHB Ndr FSH1
Other DBs
NCBI-ProteinID: BAC69679
NITE: SAV1968
UniProt: Q82LP2
Position
complement(2405547..2406842)
AA seq 431 aa
MSETPMNTLQYRFDGPEDAPVLILGPSLGTTWHMWDRQVPELMKQWRVFRFDLPGHGGAP
AHPAGSVTDLAARLLATLDALGVHRFGYAGCALSGAVGAELALRHPERLASLALIAASPR
FGTADEFRQRGVIVRTNGLDPIARTSPERWFTGGFAAAQPAITEWAVQMVRTTDPGCYIA
SCEALAAFDVRAELSRIGVPTLVLVGSDDQVTGPAEARTLVAGIPDARLAVVPGASHLVP
VEQPAAVTDLLVRHFSTAWQPAFESTTGQTAIPAAPVKPVLAAPAPVAPVAEIAPAAMQP
EPAGRPDRYETGLKVRREVLGDAHVDRALASADAFSGDFQEFITRYAWGEIWDRPGLDRR
ARSCVTLTALVAGGHLDELAFHTRAALRNGLTPVEIKEVLLQAAVYCGVPAANSAFKVAQ
QVIREETTPQE
NT seq 1296 nt   +upstreamnt  +downstreamnt
gtgagtgagacaccgatgaacaccctgcaataccgctttgacgggccagaagacgccccg
gtcctgatcctcggtccctcactgggtaccacatggcacatgtgggaccggcaggtcccg
gagctgatgaagcagtggcgggtgttccggttcgacctgccgggacacggcggcgcgccc
gcgcaccccgcggggtccgtcaccgacctggccgcccggctgctggccacgctcgacgcc
ctcggcgtgcaccggttcggctacgcgggctgcgcgctcagtggtgccgtcggcgccgag
ctggcactgcgccaccccgaacgcctcgcctcgctcgcgctgatcgccgcctcgccgcgc
ttcggcacggccgacgagttccggcagcgcggcgtgatcgtacggacgaacgggctcgac
cccatcgcccgtacgtccccggagagatggttcaccggcgggttcgccgccgcccagccc
gcgatcacagagtgggccgtgcagatggtgcggacgaccgaccccggttgttacatcgcg
tcctgcgaggcactcgccgccttcgacgtacgcgccgaactcagccggatcggcgtcccg
acgctggtcctcgtcggctcggacgaccaggtcaccggccccgccgaggcgcgcaccctg
gtcgccgggataccggacgcccggctcgcggtcgtgcccggcgcctcccatctggtgccg
gtggagcagcccgcggcggtcaccgatctgctcgtgcggcacttctccaccgcctggcag
cccgccttcgagtcgaccaccggccagacggcgattcccgcggcccccgtgaagccggtg
ctcgccgcgccggcaccggtcgcgccggtcgccgagatcgcgccggccgccatgcagccg
gagcccgcgggcaggcccgaccgctacgagaccgggctcaaggtgcgccgcgaggtgctc
ggcgacgcgcatgtcgaccgggccctggcctcggcggacgcgttctccggggatttccag
gagttcatcacccggtacgcgtggggcgagatctgggaccggcccgggctggaccggcgc
gcgcgcagctgcgtcacgctcaccgcgctggtcgcgggcggccacctcgacgagctcgcc
ttccacacccgcgcggccctgcgcaacgggctcacgccggtggagatcaaggaggtgctc
ctccaggcggcggtctactgcggcgtaccggccgcgaacagcgccttcaaggtggcccag
caggtcatccgggaggagaccacgccccaggagtga

KEGG   Streptomyces avermitilis: SAVERM_6757
Entry
SAVERM_6757       CDS       T00126                                 

Definition
(GenBank) putative carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_6757
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     SAVERM_6757
SSDB
Motif
Pfam: CMD Maf_N
Other DBs
NCBI-ProteinID: BAC74468
NITE: SAV6757
UniProt: Q828B2
Position
complement(8075306..8075743)
AA seq 145 aa
MSDATTREERFEHGLRVLKQVDGEAGERVVAALGDINPELGHQIVSWAFGDIYDRPGLAP
RDRQLVTLGMLTALGGCEVQLEVHVNAALNVGLSPDEIVEALLHSAVYCGIPKAMNASLV
AKKVFAERGLPPAGQQPTAAAATSA
NT seq 438 nt   +upstreamnt  +downstreamnt
atgagcgacgccaccacccgcgaagagcgcttcgagcacggcctgcgggtcctgaagcag
gtcgacggcgaggccggggagcgcgtcgtcgccgccttgggcgacatcaatcccgaactg
ggccaccagatcgtctcctgggccttcggcgacatctacgaccgccccggactcgccccg
cgcgaccgccagttggtgacgctcggcatgctcaccgcgctcggcggctgtgaggttcag
ctggaggtgcacgtcaacgcggcgctgaacgtgggcctttcgccggacgagatcgtcgag
gcgctgctgcactcggcggtgtactgcggcatacccaaggcgatgaacgcctccctcgtc
gcgaagaaggtcttcgccgagcgtgggctgccgcccgccggacagcagcccacggccgcc
gcggctacctctgcctga

DBGET integrated database retrieval system