KEGG   Streptomyces avermitilis: SAVERM_1730
Entry
SAVERM_1730       CDS       T00126                                 

Definition
(GenBank) putative proline racemase
  KO
K01777  proline racemase [EC:5.1.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_1730
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.4  proline racemase
     SAVERM_1730
SSDB
Motif
Pfam: Pro_racemase PhzC-PhzF DAP_epimerase
Other DBs
NCBI-ProteinID: BAC69441
NITE: SAV1730
UniProt: Q82MD0
Position
complement(2111948..2112949)
AA seq 333 aa
MRSKLVLHAVDSHTEGMPTRVITGGIGTIPGATMNERRLYFREHRDDIRQLLMNEPRGHS
AMSGAVLQPPARPDCDVGVVYIEVSGYLPMCGHGTIGVATVLVETGMVEVVEPVTTIRLD
TPAGLVVAEVAVEDGAARAVTLKNVPSFCVGLDRKATLADGRTVTYDLAYGGNFYAILPL
GEFGLPFDRSRKDDILKAGLSLMDAVNADGGPVHPEDPSIRGCHHVHLVAPGSDARHSRH
AMAIHPGWFDRSPCGTGTSARMAQLHARGELPLGTEFVNESLIGTRFTGRLLGTTEVAGI
PAVLPSFTGRAWVTGTAQYLLDPEDPFPAGFVL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgcgcagcaaactcgtcctgcacgccgtcgactcgcacaccgagggcatgccgacccgg
gtgatcaccggcggcatcggcacgatccccggcgcgaccatgaacgaacggcgcctgtac
ttccgtgaacaccgcgacgacatcaggcagttgctgatgaacgagccgcgcggtcactcg
gccatgagcggcgcggtcctccagcctcccgcgcgccccgactgcgatgtcggcgtcgtc
tacatcgaggtctccggctatctgccgatgtgcggccacggcacgatcggcgtcgcgacc
gtgctcgtggagaccggcatggtcgaggtcgtcgagccggtcaccacgatccgcctcgac
accccggcgggcctcgtcgtcgccgaggtggcggtcgaggacggcgccgcccgggccgtc
acgctcaagaacgtgccgtccttctgcgtcggcctcgaccgcaaggccacgctcgccgac
ggccgcacggtgacgtacgacctcgcgtacggcgggaacttctacgcgatcctgccgctg
ggggagttcggactgcccttcgaccggtcccgcaaggacgacatcctcaaggcgggcctg
tccctgatggacgccgtcaacgcggacggcgggcccgtccaccccgaggacccgtccatc
cgcggctgccaccacgtccacctcgtcgcgcccggctccgacgcccgccactcccggcac
gcgatggccatccatcccggctggttcgaccgctcgccgtgcggcaccggaaccagcgcc
cgtatggcgcagttgcacgcgcgcggtgaacttccgctcggcaccgagttcgtcaacgag
tccctcatcgggacccggttcaccggccggctgctcggcacgaccgaggtggccggcatc
cccgccgtcctgcccagcttcaccgggcgcgcctgggtcaccgggacggcccagtacctg
ctggaccccgaggaccccttcccggcggggttcgtgctgtag

DBGET integrated database retrieval system