KEGG   Streptomyces avermitilis: SAVERM_1731
Entry
SAVERM_1731       CDS       T00126                                 

Gene name
dapA1
Definition
(GenBank) putative dihydrodipicolinate synthase
  KO
K21062  1-pyrroline-4-hydroxy-2-carboxylate deaminase [EC:3.5.4.22]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_1731 (dapA1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.22  1-pyrroline-4-hydroxy-2-carboxylate deaminase
     SAVERM_1731 (dapA1)
SSDB
Motif
Pfam: DHDPS Amidohydro_2 RNA_pol_Rpc34
Other DBs
NCBI-ProteinID: BAC69442
NITE: SAV1731
UniProt: Q82MC9
Position
complement(2112964..2113854)
AA seq 296 aa
MTVHRPWRGVLVATALPLTADLAVDHDKFAEHCAWLVEQGCDGVVPNGSLGEYQVLTPEE
RARVVETAVSAVGGARVMPGVAAYGSAEARRWAEQARDAGCRAVMLLPPNAYRADERSVR
AHYAEVAKAGVPVVAYNNPIDTKVDLVPELLAALHGEGYIHAVKEFSGDVRRAYRLAELA
PELDLLIGADDVLLELAVAGAKGWVAGYPNALPAASVELYHAAVDGDLATATQLYRQLHP
LLRWDSRVEFVQAIKMSMDVVGRYGGPVRPPRVPLLPEQETAVRAATEKAVAAGLA
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaccgtccaccgcccctggcgcggcgtgctcgtcgccaccgcgctcccgctcaccgcc
gacctcgccgtcgaccacgacaagttcgccgagcactgcgcctggctcgtcgagcagggt
tgcgacggagtcgtgccgaacggctcgctcggtgagtaccaggtgctcacccccgaggag
cgcgccagggtcgtcgagacggccgtgtccgccgtcggcggcgcgcgggtgatgcccggg
gtcgccgcctacggatcggcggaggcccggcgctgggccgaacaggcccgggacgccggc
tgccgggcggtcatgctgctgccgccgaacgcctaccgggccgacgagcgttccgtacgc
gcccactacgcggaggtcgccaaggcgggcgtgccggtcgtcgcgtacaacaaccccatc
gacaccaaggtcgacctcgtgcccgaactgctcgccgcgctgcacggcgaggggtacatc
cacgcggtcaaggagttctcgggggatgtccgccgcgcctaccggctggccgaactcgcc
ccggaactcgatctgctgatcggcgcggacgacgtcctgctggaactcgcggtcgcgggc
gccaagggctgggtggccggctacccgaacgcactgcccgcggcgagcgtcgagctgtac
cacgcggccgtcgacggcgacctcgccaccgccacacagctgtaccggcagctgcacccg
ctgctgcgctgggactccagggtcgagttcgtgcaggccatcaaaatgtccatggacgtc
gtcgggcggtacggcggcccggtacgcccgccgcgcgtcccgctgctgcccgagcaggag
accgccgtccgcgccgccacggagaaggccgtggcggcggggctcgcgtaa

DBGET integrated database retrieval system