KEGG   Streptomyces avermitilis: SAVERM_1732
Entry
SAVERM_1732       CDS       T00126                                 

Definition
(GenBank) putative oxidoreductase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_1732
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     SAVERM_1732
SSDB
Motif
Pfam: Pyr_redox_2 Fer2_BFD HI0933_like NAD_binding_8 GIDA FAD_binding_2 Pyr_redox_3 FAD_oxidored DAO FAD_binding_3 NAD_binding_9 Pyr_redox Thi4 AlaDh_PNT_C Lycopene_cycl 3HCDH_N
Other DBs
NCBI-ProteinID: BAC69443
NITE: SAV1732
UniProt: Q82MC8
Position
complement(2113851..2115350)
AA seq 499 aa
MRAEPARAESARAELAVIGAGPAGLAAALAAGARGVRVTLIDSAAQAGGQFYRRPDPALE
ARRPQVLHHRWRTWERLRDGLAAQVGTGGVKHLTEHQVWLVERQSTGFTVHALRAESPVV
VHADAVLLATGGYEKVLPFPGWTLPGVLTAGGAQAMLKGGLAVAGGTAVVAGTGPLLLPV
ATGLAAAGVEVAALVEAADPKTLVRHARALAVKLPEGARYAARLLRHRVEFLGRHTVVEA
HGGERLAAVTVAALDAGGRVRTGTERRILCDTLAVGHGMLPHTDLAETLGCRVDGLNVSV
DEEQRTSVPGVWAAGETTGIGGAALSLAEGHIAGRSIAARLAGREPDPRAWAAAAKSRTR
LRQFAAVLDTVYAPPAHWSDRVTDDTVVCRCEEVTGGAIREAVEELGAGDLRTVKLLTRA
GMGWCQGRMCGPAVAGLAGCQLAPSSGPFARPVPLGVLARAADGHRSEAPTADHGDEAPA
DGRRAEAPADDHLTQRGPS
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgagggctgagccggccagggctgaatcggccagggctgagctggccgtgatcggcgcg
ggcccggcgggcctcgccgccgccctggccgcgggcgcgcgcggagtgcgcgtcacgctg
atcgactcggctgcccaggcgggcggtcagttctaccgccggcccgaccccgcgctcgag
gcgcggcgaccgcaggttctgcaccatcggtggcggacctgggaacggctgcgcgacggg
ctcgccgcacaggtcggaacaggaggagtcaagcacctgaccgaacatcaggtgtggctc
gtggaaaggcagtcgacgggtttcacggtccacgcccttcgtgcggagagcccggtcgtc
gtccacgccgacgccgtcctcctcgccaccggcggctacgagaaggtgctgccgtttccc
ggctggaccctccccggcgtactgaccgcgggcggggcgcaggcgatgctcaagggcggc
ctcgcggtggcgggcggtaccgcggtcgtggccggcaccgggccgctgctgctgcccgtg
gcgaccgggctggccgcggcgggcgtcgaggtcgcggcgctggtggaggcggcggacccg
aagacgctcgtacggcatgcgcgcgctctcgcggtcaagctgcccgaaggcgcccggtac
gcggctcggctcctgcggcaccgtgtcgagttcctcggccggcacaccgtcgtcgaggcg
cacggcggtgagcggctggcagccgtgaccgtcgccgccctcgatgccggcggacgcgta
cggaccggcaccgagcggcgcatcctctgcgacaccctcgccgtcggacacggcatgctc
ccgcacaccgacctcgccgagacgctcggctgtcgcgtcgacgggctgaacgtctccgtc
gacgaggaacagcgcacctccgtccccggtgtatgggccgcgggcgagaccaccggcatc
gggggcgccgcgctgtcgctcgccgaggggcacatcgccggacggtcgatcgccgcccgg
ctcgcgggccgcgaacccgacccgcgcgcctgggcggcggccgccaagtcccgtacccga
ctgcggcagttcgccgccgtgctcgacaccgtgtacgcgccgcccgcccactggagcgac
cgggtcaccgacgacaccgtcgtctgccgctgcgaggaggtcaccggcggtgcgatccgg
gaggccgtcgaggagctcggcgccggtgacctgcgtaccgtcaagctgctcacccgcgcc
gggatgggctggtgccagggccggatgtgcgggcccgcggtcgccggactcgccggatgc
caactcgccccgtccagtgggccgttcgcacgacccgtaccgctcggcgtactcgcccgg
gccgccgacggccaccggagcgaggctcccaccgccgaccacggggacgaggcccccgcg
gacggccgtcgagccgaggcccccgccgacgatcacctcacccagagaggaccctcatga

DBGET integrated database retrieval system