KEGG   Streptomyces avermitilis: SAVERM_1753Help
Entry
SAVERM_1753       CDS       T00126                                 

Gene name
ama1
Definition
(GenBank) putative alpha-mannosidase
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_1753 (ama1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sma04131]
    SAVERM_1753 (ama1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     SAVERM_1753 (ama1)
Membrane trafficking [BR:sma04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    SAVERM_1753 (ama1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2 Glyco_hydro_57 SCAN
Motif
Other DBs
NCBI-ProteinID: BAC69464
NITE: SAV1753
UniProt: Q82MA7
Position
complement(2135431..2138499)
Genome map
AA seq 1022 aa AA seqDB search
MHDERRRIEERVERIHNQRIKPAVYAAAVPFAVEAWQAPGEPVPFEEAAAASYAPFAMDT
PWGPPWGTTWFRMRGRVPAEWAGRRVEAVIDLGFTGDWPGNQAEALVHRTDGTPLKAVNP
LNQYVPIGNPATGGEEIDYLVEAASNPDILAGDFARPTPLGDVLTAGDKPLYTFRRADLA
ILDEEVWHLDLDVQVLRELMLELGEHDPRRHEIMHTLDRALDALDLDDISGSATAVREVL
APALARPAHASAHTLSGVGHAHIDSAWLWPIRETKRKTSRTFSNVTSLADEYDDFIFACS
QAQQYEWVRDNYPHVWARIQESVKKGQWAPVGGMWVEADGNLPGGEALARQLIHGKRFFI
EHFGVETKGVWLPDSFGYNASYPQLAKLAGNEWFLTQKLSWNQTNKLPHHTFWWEGIDGT
RIFTHFPPIDTYNARFSGEEMSRTVRNYADKGRGTRSLAPFGWGDGGGGPTREIMERARR
LADLEGSPKVVVEHPDAFFKAAREEYPDAPVWVGELYLELHRATYTSQARTKQGNRRSEH
KLREAELWATTAALHAPGYAYPYEKLDRLWKTVLLHQFHDILPGSSIAWVHREAEAEYAR
VATELEELTAEAVAALGGGGPRVFNTSPRDRAEVVRTSTGAPAYVEVPAGGSAPLDGAAP
PRPVTVTGRVLDNGLVRVEVAEDGTLASVRDLTADREVLADQGNLLRLHTDLPNYWDAWD
IDKHYKNRYTDLLDADSVTVVEQDPLIGAIRVERSFGKGSKITQTITVRAGSRRIDVETE
IDWHEAEKILKAAFPVDLRAPHSSAEIQFGHVQRPTHTNTSWEAARFEVYGHRWVHIGEP
GYGVAVINDSTYGHDVSRTVREDGGTTTTVRLSLVRAPRVPDPEADQGRHRFTYALLPGA
SIEDAVAEGYALNLPLRVADAQGAPEPVVSVDGAGLTVEAVKLADDASGDVVVRLYESGG
GRSRGTLRTGFPLAGVHVTDLLERPLAEGAGDAVVDGDGAVAVELRPFQVLTLRLKRAAT
AQ
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgaacgccgccggatcgaggagcgcgtagagcgcatccacaaccagcgcatc
aagcccgcggtctacgcggccgccgtccccttcgccgtcgaggcctggcaggcgccgggc
gagcccgttcccttcgaggaggccgcggccgcctcgtacgcgccgttcgccatggacacc
ccgtgggggccgccctggggcaccacctggttccggatgcgcggccgggtgcccgccgaa
tgggccgggcggcgcgtcgaggcggtcatcgacctcggcttcaccggcgactggcccggc
aaccaggccgaggcgctggtccaccgcaccgacggcaccccgctcaaggcggtcaacccg
ctcaaccagtacgtgccgatcggcaacccggccacgggcggcgaggagatcgactacctg
gtcgaggcggcctccaaccccgacatcctcgcaggcgacttcgcgcgcccgaccccgctc
ggcgacgtcctcaccgcgggcgacaagccgctctacaccttccgccgcgccgacctcgcc
atcctcgacgaggaggtctggcacctcgatctggacgtccaggtgctgcgcgagctgatg
ctggagctgggcgagcacgacccgcgccggcacgagatcatgcacaccctggaccgggcc
ctggacgcgctggacctggacgacatctccggcagcgcgacggccgtccgcgaggtcctg
gccccggccctcgcgaggcccgcgcacgccagcgcccacaccctctccggcgtcggccac
gcgcacatcgactccgcctggctgtggccgatccgcgagaccaagcggaagacgtcccgc
accttctccaacgtcacctcgctcgccgacgagtacgacgacttcatcttcgcctgctcg
caggcccagcagtacgagtgggtgcgcgacaactacccgcacgtgtgggcccgcatccag
gagtcggtgaagaagggccagtgggcgccggtcggcggcatgtgggtcgaggccgacggc
aacctgcccggcggcgaggcgctggcccgccagctgatccacggcaaacggttcttcatc
gagcacttcggcgtcgagaccaagggcgtgtggctgccggactccttcggctacaacgcc
tcctacccgcagctcgccaagctcgccggcaacgagtggttcctgacccagaagctctcc
tggaaccagaccaacaagctgccccaccacaccttctggtgggagggcatcgacggcacc
cgcatcttcacgcacttcccgccgatcgacacctacaacgcccgcttcagcggcgaggag
atgtcccgcacggtccgcaactacgcggacaagggccgcggtacgcgctccctggcaccg
ttcggctggggcgacggcggtggcggccccacccgcgagatcatggaacgggcgcgcagg
ctggcggacctggagggctcgccgaaggtcgtcgtcgaacatcccgacgcgttcttcaag
gccgcccgcgaggagtacccggacgccccggtctgggtcggcgagctctacctggagctg
caccgcgccacctacacctcccaggcccgcaccaagcagggcaaccgccgcagcgaacac
aagctgcgcgaggccgagttgtgggcgacgacggccgccctgcacgcgccgggctacgcc
tacccgtacgagaagctggaccgcctgtggaagacggtcctgctccaccagttccacgac
atcctgccgggctcgtcgatcgcctgggtgcaccgggaggccgaggccgaatacgcccgg
gtggccacggaactggaggagctgacggccgaggcggtggccgcgctcggcggcggcggt
ccgcgcgtcttcaacacgagcccccgcgaccgcgccgaggtggtccgtacgtccaccggg
gccccggcgtacgtggaggtaccggcgggcggcagcgctcccctcgacggcgccgcaccc
ccgcggccggtgacggtcaccggccgcgtcctcgacaacggcctggtccgcgtcgaggtc
gccgaggacggaaccctcgcctccgtaagggatctgacggcggaccgcgaagtcctcgcc
gaccagggcaacctgctccggctgcacaccgacctcccgaactactgggacgcctgggac
atcgacaagcactacaagaaccgctacacggacctgctggacgccgactccgtcacggtc
gtcgaacaggacccgctgatcggcgcgatccgggtggagcgctccttcggcaagggttcg
aagatcacccagacgatcaccgtacgggccggcagccgccgcatcgacgtcgagacggag
atcgactggcacgaggccgagaagatcctcaaggccgcgttcccggtggacctgcgcgcc
ccgcactcgtccgccgagatccagttcggccacgtccagcgccccacccacaccaatacc
agctgggaggcggcccgcttcgaggtctacggccatcgctgggtgcacatcggcgaaccc
ggctacggcgtcgccgtgatcaacgactccacctacggccacgacgtctcccgcacggtc
cgcgaggacggcggcacgaccaccacggtccgcctcagcctggtccgcgccccgcgcgtg
ccggaccccgaggccgaccagggccggcaccgcttcacctacgcgctgctgcccggcgcg
agcatcgaggacgcggtcgcggagggctacgccctcaacctgccgctgcgggtcgcggac
gcccagggagcgccggagccggtcgtgtccgtcgacggcgccggcctcaccgtcgaagcg
gtcaagctcgccgacgacgcctcgggcgatgtcgtcgtgcgcctctacgagtcgggcggc
ggccggtcccggggcaccctgcgcaccggcttcccgctcgcgggcgtccacgtcaccgac
ctgctggagcgaccgctcgccgagggggccggcgacgcggtcgtcgacggtgacggcgcg
gtcgccgtggaactgcggcccttccaggtactgacgctccgtctgaagcgcgccgcgacc
gcccagtag

KEGG   Streptomyces avermitilis: SAVERM_7277Help
Entry
SAVERM_7277       CDS       T00126                                 

Gene name
ama2
Definition
(GenBank) putative alpha-mannosidase
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
sma  Streptomyces avermitilis
Pathway
sma00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_7277 (ama2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sma04131]
    SAVERM_7277 (ama2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     SAVERM_7277 (ama2)
Membrane trafficking [BR:sma04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    SAVERM_7277 (ama2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2 SCAN
Motif
Other DBs
NCBI-ProteinID: BAC74988
NITE: SAV7277
UniProt: Q826B6
Position
8677864..8680878
Genome map
AA seq 1004 aa AA seqDB search
MHDDRTLVEARLRRVLDERIRPAVYPESVPLEVAVWHAPDEPVPVAEGLAAPVGPIAAGA
RWGAPWGTSWFRVTGTVPEAWAGKTVEALLDLGFDENMPGFQCEGLVYRPDGTPVKGLNP
RNQWVRIGAPVEGGEEVRLHIEAASNPVILDYHPFRPTQLGDKETAGSEPQYRLERMDLA
VFDETVWQLVIDLEVLGELMAELPVESARRWDLLRAVERALDAVDLQNVNGTAAAARARL
EGVLAEPAVPSAHHISAVGHAHIDSAWLWPLRETVRKVARTTSNMTALIEDEPDFVFAMS
QAQQWAWVKEHRPEVWARVKKAVAEGRFVPAGGMWVESDTNMPGSEAMARQFVHGKRFFL
DEFGIENDEAWLPDTFGFAAGLPQIIKAAGSKWLLTQKISWSQTNKFPHHTFRWEGIDGT
RIFTHFPPVDTYNCSMKGSEIAHAARNFKDKGVARHSLAPTGWGDGGGGTTREMIAKAAR
LRDLEGSATVAWETPAKFFEQAEAEYPDPPVWVGELYLELHRATLTSQAKTKQGNRRSEH
LLREAELWAATAAVRTGFPYPYEELDRIWKTVLLHQFHDILPGSSIAWVHREARKTYEKV
AEELNGVIDAAQRALAGEGTTPLVFNSAPHTRDGVPAGGARTPAVGGECALVPRADGGYV
MENGRLRVEIDAHGLVVSAFDLAADRETVAPGRPANLLQLHPDFPNMWDAWDVDEFYRNT
VTDLVDADEIAPGEDGVSVRIVRTFGASRVTQVLSLAPGEWRLDIDTEVDWHETEKFLKL
AFPLDVHAERYASETQFGHFFRPTHTNTSWEAAKFEACNHRFVHMEEPGWGVAVVNDSTY
GHDVTRTVRDDGGTTTTVRVSLLRAPRFPDPETDQGVHRFRHALVPGAGIGDAVREGWRI
NVPERKVTGGREVTPLLAVTQDAVVVTAVKLADDGSGDVVVRFHESRGGRTRATLKAGFE
VAAVSVTDLLERPLADAREPAVDGDRITLSLRPFELVTLRLRRA
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgaccgcaccctggtcgaagcccgcctccggcgcgttctcgacgagcgcatc
cgccccgccgtgtaccccgagtccgtaccgctggaggtggcggtgtggcacgcgccggac
gagccggtgccggtcgccgaagggctcgccgccccggtcggcccgatcgcggcgggcgca
cgctggggtgctccctggggcaccagctggttccgcgtcaccgggaccgtccccgaggcc
tgggccggcaagaccgtcgaggccctgctggacctcggcttcgacgagaacatgcccggc
ttccagtgcgaggggctcgtctaccgtcccgacggcaccccggtgaagggcctcaacccg
cgcaaccagtgggtgcggatcggcgcacccgtcgagggcggggaagaggtccggctgcac
atcgaggcggcgtccaaccccgtgatcctcgactaccacccgttcaggccgacccagttg
ggcgacaaggagacggcgggcagtgagccgcagtacaggctggagcgcatggatctcgcc
gtcttcgacgagacggtgtggcagctcgtcatcgacctcgaggtcctcggcgagctgatg
gccgaactgccggtggagtcggcgcgccgctgggacctcctgcgcgcggtggagcgggcg
ctcgacgcggtcgatctccagaacgtcaacggcacggcggcagcggcgcgcgcccggctc
gaaggggtgctcgcggaacccgccgtgccctccgcgcaccacatcagcgccgtcggccat
gcgcacatcgactcggcctggctgtggccgctgcgcgagacggtgcgcaaggtggcgcgg
acgacctccaacatgaccgcgctgatcgaggacgagcccgacttcgtcttcgccatgtcg
caggcgcagcagtgggcctgggtgaaggagcaccggcccgaggtgtgggcgcgggtgaag
aaggccgtggccgagggacggttcgtgccggccggcggtatgtgggtcgagtcggacacg
aacatgccgggatccgaggcgatggcccgtcagttcgtgcacggcaagcggttcttcctc
gacgagttcggcatcgagaacgacgaggcctggctgcccgacacgttcggcttcgcggcc
ggactgccccagatcatcaaggcggcgggctccaagtggctgctgacgcagaagatctcg
tggtcgcagaccaacaagttcccccaccacaccttccggtgggagggcatcgacggaacg
cggatcttcacccacttcccgcccgtcgacacctacaactgctccatgaagggcagcgag
atcgcccacgcggcacgcaacttcaaggacaagggagtggcccggcactcgctcgcgccc
accggctggggcgacggaggcggcggcacgacccgcgagatgatcgccaaggcggccagg
ctccgcgatctcgaaggctcggcgacggtcgcctgggagacacccgcgaagttcttcgag
caggccgaggccgaatatcccgacccgcccgtctgggtcggcgagctgtacctcgaactg
caccgcgccacactcaccagccaggcgaagaccaagcagggcaaccgccgcagcgaacac
ctcctgcgcgaggcggaactctgggcggccaccgcggcggtccgcaccggattcccttac
ccgtacgaggagttggaccgtatctggaagacggtgctgctccaccagttccacgacatc
ctgcccggctcgtccatcgcgtgggtgcaccgggaggccaggaagacgtacgagaaggtc
gccgaggagctgaacggcgtcatcgacgccgcgcagcgcgcgctggccggcgaggggacg
acgccgctcgtcttcaactcggcgccgcacacccgtgacggggtgcccgccggcggtgcg
cggaccccggccgtcgggggcgagtgcgcgctcgtgccccgcgcggacggcggttatgtc
atggagaacgggcggctgcgggtcgagatcgacgcacacggactcgtggtctccgccttc
gacctcgccgcggaccgcgagaccgtcgcaccgggccggccggcgaacctgctccagctg
caccccgacttccccaacatgtgggacgcctgggacgtcgacgagttctaccgcaacacg
gtgaccgacctggtcgacgccgacgagatcgcccccggtgaggacggcgtctcggtgcgg
atcgtccggaccttcggcgcgtcccgtgtcacccaggtgctgtcgctcgcgccgggggag
tggcggctggacatcgataccgaggtcgactggcacgagaccgagaagttcctgaagctc
gccttcccgctcgacgtgcacgcggaacgctacgcgtccgagacccagttcgggcacttc
ttccggccgacgcacaccaacacgtcctgggaggccgccaagttcgaggcgtgcaaccac
cggttcgtgcacatggaggagcccggctggggtgtcgcggtcgtcaacgactcgacgtac
ggccacgacgtgacccgtaccgtgcgcgacgacggcggtacgaccaccacggtgcgtgtc
tcgctgctgcgggccccgcgcttcccggaccccgagaccgaccagggcgtgcaccggttc
cgacacgctctggtgcccggcgccgggatcggggacgccgtgcgtgagggctggcggatc
aacgtgccggagcggaaggtcaccggcgggcgggaggtgacgccgctgctggccgtcacc
caggacgcggtcgtggtgaccgcggtcaagctggccgacgacggcagcggtgacgtggtc
gtccgcttccacgagtcccgcggcggccggacccgggccacgctcaaggccggcttcgag
gtcgcggcggtctcggtgacggacctgctggaacgcccgctggcggacgcacgggagccg
gccgtggacggcgaccgcatcacgctgtcgctgcgtcccttcgaactggtgacgctccgc
ctccggcgcgcctga

DBGET integrated database retrieval system