KEGG   Streptomyces avermitilis: SAVERM_1754
Entry
SAVERM_1754       CDS       T00126                                 

Gene name
bglA1
Definition
(GenBank) putative 6-phospho-beta-glucosidase
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1754 (bglA1)
   00500 Starch and sucrose metabolism
    SAVERM_1754 (bglA1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SAVERM_1754 (bglA1)
SSDB
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4
Other DBs
NCBI-ProteinID: BAC69465
NITE: SAV1754
UniProt: Q82MA6
Position
complement(2138564..2139901)
AA seq 445 aa
MKLTILGGGGFRVPLVYGALLGDRAEGRVTRVVLHDLDAGRLTAVARVLAEQAAGDPDAP
EVSFTTDLDEALRGADFVFSAIRVGGLEGRADDERVALAEGVLGQETVGAGGIAYGLRTV
PVAVDIARRVARLAPDAWVINFTNPAGLVTEAMSRHLGDRVIGICDSPVGLGRRIARVLG
ADPREAFIDYVGLNHLGWVRGLRVAGRDELPRLLADPGLLGSFEEGKLFGPDWLRSLGAI
PNEYLHYYYFNREAVRAYSEAEKTRGAFLRDQQARFYEEMKRADSSALSAWDRTRAEREA
TYMAENRDAAGAGERDADDLSGGYEKVALALMRAIARDERTTLILNVRNRGALTVLDAEA
VIEVPCLVDANGAHPVAVDPLPGHATGLVCAVKAVEREVLSAAESGSRATAVKAFALHPL
VDSVNVARRLVDGYTSVHPGLTYLK
NT seq 1338 nt   +upstreamnt  +downstreamnt
gtgaagctgacgattctgggcggtggcgggttccgggtgccgctcgtgtacggggcgctc
ctcggggaccgcgccgagggccgcgtcacccgggtcgtgctgcacgacctggacgcgggg
cggctcacggccgtggcccgcgtgctcgccgaacaggccgccggggatccggacgcgccc
gaggtgagcttcaccaccgacctggacgaggccctgcgcggcgccgacttcgtcttctcc
gcgatccgcgtcgggggactggaggggcgcgccgacgacgagcgggtggcgctggcggag
ggtgtgctgggccaggagacggtcggcgcgggcggcatcgcgtacggactgcgcacggtc
ccggtcgccgtcgacatcgcgcggcgcgtggcccggctcgcccccgacgcctgggtcatc
aacttcaccaacccggcgggcctggtcaccgaggccatgtcacgccacctcggcgaccgt
gtcatcggcatctgcgactcgccggtcggcctcggccggcgcatcgcccgcgtgctcggc
gccgacccgcgcgaggccttcatcgactacgtcggcctcaaccacctcggctgggtacgc
ggtctgcgcgtcgcgggccgcgacgaactcccgcgcctgctcgccgaccccggactgctc
ggctccttcgaggagggcaagctcttcggccccgactggctccggtcgctgggcgcgatc
cctaacgagtacctgcactactactacttcaaccgggaagccgtacgcgcctacagcgag
gccgagaagacccggggcgccttcctgcgcgaccagcaggcgcggttctacgaggagatg
aagcgggcggactcctccgccctgtcggcctgggaccgcacccgtgccgagcgcgaggcc
acgtacatggccgagaaccgcgacgcggcgggcgccggcgagcgcgacgccgacgacctc
tccggcggctacgagaaggtggccctcgccctgatgcgggccatcgcccgggacgagcgc
acgacgctgatcctcaacgtccgcaatcgcggcgcgctcacggtcctcgacgccgaggcc
gtcatcgaagtcccgtgcctcgtcgacgccaatggcgcgcacccggtcgccgtcgacccg
ctccccggccacgccacgggcctggtgtgcgcggtgaaggcggtcgagcgcgaggtgctg
tccgcggccgagtccggctcccgtgcgacggccgtgaaggccttcgcgctgcaccccctc
gtggactccgtgaacgtggcccgcaggctggtcgacggatacacctcggtccacccaggt
ctgacgtaccttaagtaa

KEGG   Streptomyces avermitilis: SAVERM_5380
Entry
SAVERM_5380       CDS       T00126                                 

Gene name
bglA2
Definition
(GenBank) putative 6-phospho-beta-glucosidase
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5380 (bglA2)
   00500 Starch and sucrose metabolism
    SAVERM_5380 (bglA2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SAVERM_5380 (bglA2)
SSDB
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Other DBs
NCBI-ProteinID: BAC73092
NITE: SAV5380
UniProt: Q82CH0
Position
complement(6524786..6526051)
AA seq 421 aa
MKLAVVGGGSTYTPELIDGFARLRDTLPVEELVLVDPAADRLELVGGLARRIFARQGHDG
RIVTTSDLDAGVEGADAVLLQLRVGGQAAREQDETWPLECGCVGQETTGAGGLAKALRTV
PVVLDIAERVRRANPDAWIIDFTNPVGIVTRALLQAGHKAVGLCNVAIGFQRKFAGLLGV
APADVHLDHVGLNHLTWETGVRLGGPEGENVLPKLLAEHGDAVAGDLRLPRSIVDRLGVV
PSYYLRYFYAHDEVVRELGTKPSRAAEVARMERRLLEMYGDPALDEKPALLAERGGAYYS
EAAVDLAASLLGGGGSPYQVVNAYNKGTLPFLPDDAVIEVQAAVGPHGPTPLPVPPVDPL
YAGLMANVTAYEDLALEAALRGGRDRVFRALLAHPLIGQYGYADALTDRLIAHNREHLAW
A
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaaactggcagttgtgggcggggggtccacgtacacccccgaactcatcgacggcttc
gcccggttgcgggacacgctgcccgtcgaggaactggtcctcgtcgacccggccgccgac
cgcctcgaactggtgggcggcctcgcccggcgcatcttcgccaggcagggccacgacggc
aggatcgtcaccacgtccgacctggacgcgggcgtcgagggcgccgacgcggtgctgctc
cagctgcgcgtgggcggacaggccgcacgcgagcaggacgagacctggccgctggagtgc
ggctgcgtcggccaggagacgacgggcgcgggcggtctcgccaaggcgctgcgcacggtg
ccggtggtgctggacatcgccgagcgcgtccgccgcgccaacccggacgcctggatcatc
gatttcaccaatccggtggggatcgtgacgcgcgccctgctccaggccggtcacaaggcc
gtcgggctgtgcaacgtggcgatcggcttccagcggaagttcgccgggctgctcggcgtc
gcccccgccgacgtccacctcgaccacgtcggcctcaaccacctcacctgggagaccggg
gtgcgcctgggcggccccgagggcgagaacgtcctgcccaagctgctcgccgagcacggt
gacgccgtcgcgggcgacctgcgcctgccgcgcagcatcgtcgaccggctcggcgtcgtc
ccctcgtactacctgcgctacttctacgcgcacgacgaggtcgtacgagagctcgggacc
aaaccctcgcgggccgcggaggtcgcgcggatggagcggcggttgctggagatgtacggc
gaccccgcgctcgacgagaagccggcgctgctggccgagcggggtggcgcgtactactcg
gaggcggccgtggacctcgcggcctcgctgctgggcgggggaggcagcccgtaccaggtg
gtgaacgcctacaacaagggcacgttgcccttcctgcccgacgacgcggtgatcgaggtg
caggccgcggtcggcccgcacggccccaccccgctgccggtgccgccggtggacccgctg
tacgcggggctgatggcgaacgtcacggcgtacgaggacctggcccttgaggccgcgctg
cgcggcggacgcgaccgggtgttccgggcgctgctcgcgcacccgctgatcggccagtac
gggtacgccgacgccctcaccgaccggctgatcgcgcacaaccgggagcacctcgcgtgg
gcgtga

DBGET integrated database retrieval system