KEGG   Streptomyces avermitilis: SAVERM_1770
Entry
SAVERM_1770       CDS       T00126                                 

Gene name
pgi1
Definition
(GenBank) putative glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sma_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_1770 (pgi1)
   00030 Pentose phosphate pathway
    SAVERM_1770 (pgi1)
   00500 Starch and sucrose metabolism
    SAVERM_1770 (pgi1)
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_1770 (pgi1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_1770 (pgi1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     SAVERM_1770 (pgi1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAVERM_1770 (pgi1)
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_1770 (pgi1)
  Exosomal proteins of colorectal cancer cells
   SAVERM_1770 (pgi1)
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-ProteinID: BAC69481
NITE: SAV1770
UniProt: Q82M90
Position
2163399..2165048
AA seq 549 aa
MSDSPRLTRRPEWTELEDHRAGPLLHPALRELFAADPERAERYVVRAGDLRLDYSKHLIT
DETLALLQELATATDVFGLRDAMFRGEKINVTENRAVLHTALRAPRDAVIEVDGENVVPA
VHAVLDRMADFADRVRSGEWTGHTGSRIRTVVNIGIGGSDLGPAMAYEALRAFTDRSLTV
RFVSNVDGADLHEAVRDLDPAETLFVIASKTFTTIETITNATSARSWLLAGLDGDEKAVA
KHFVALSTNAGKVSDFGIDTANMFEFWDWVGGRYSFDSAIGLSLMIAIGPERFRELLDGF
RIVDEHFRTAPAEANAPLLLGLLGVWYGSFFGAQSHAVLPYSHYLSKFTAYLQQLDMESN
GKSVDRDGHPVEWQTGPVVWGTPGTNGQHAYYQLLHQGTKVIPADLIGFINPVDGLSDEL
AAQHDLLMANLFAQGQALAFGKTGDEVRAEGVPEEQVPHRTFRGNHPTTTILAAELTPSV
LGQLIALYEHKVFVQGAIWNIDSFDQWGVELGKVLAKRVEPALTEGADVPGLDPSTAALV
AAYRTHRKK
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtctgacagccccaggctcacccgtcgccccgagtggacggaactggaggaccatcgc
gcgggtccgctgctccacccggcgctgcgtgagctgttcgcggcggaccccgagcgggcc
gagcgctatgtcgtgcgggccggcgatctgcgcctcgactactccaagcacctcatcacg
gacgagaccctcgccctgctccaggaactcgccaccgccaccgacgtgttcgggctgcgg
gacgccatgttccggggcgagaagatcaacgtcaccgagaaccgcgccgtcctgcacacc
gcgctgcgcgccccgcgcgacgccgtgatcgaggtcgacggcgagaacgtcgtcccggcc
gtgcacgccgtgctcgacaggatggccgacttcgccgaccgggtccgctcgggcgagtgg
accgggcacaccggcagccgcatccgcacggtcgtcaacatcggtatcggcggctcggac
ctgggccccgcgatggcgtacgaggcgctgcgggccttcaccgaccgctcgctgaccgtg
cggttcgtgtcgaacgtggacggcgccgatctgcacgaagccgtacgggacctggacccg
gcggaaaccctgttcgtcatcgcgtccaagaccttcacgaccatcgagacgatcacgaac
gccacctcggcgcggtcctggctcctcgccgggctcgacggggacgagaaggcggtcgcc
aagcacttcgtggcgctgtcgacgaacgccgggaaggtgtcggacttcggcatcgacacg
gcgaacatgttcgagttctgggactgggtcggcggccgctactcgttcgactccgcgatc
ggtctgtcgctgatgatcgcgatcgggccggagcggttccgcgagctgctcgacgggttc
aggatcgtcgacgaacacttccgcaccgcgcccgcggaggccaacgcgcctttgctgctc
ggcctgctgggtgtctggtacggctcgttcttcggtgcccagtcgcacgccgtgctgccg
tactcgcactatctgtccaagttcaccgcctacttgcagcagctggacatggagtccaac
ggcaagtccgtggaccgggacggccatcccgtggagtggcagaccggcccggtggtgtgg
ggtacgcccggcaccaacggacagcacgcgtactaccagttgctccaccagggcaccaag
gtcatcccggccgacctgatcgggttcatcaacccggtcgacgggctgagcgacgaactg
gcggcccagcacgacctgttgatggccaacctcttcgcccagggccaggccctcgccttc
ggcaagaccggcgacgaggtacgcgccgagggagtgccggaggagcaggtgccgcaccgc
accttccgcggcaaccaccccaccaccacgatcctggccgccgagctgaccccgtcggtc
ctcggccagctcatcgccctctacgagcacaaggtgttcgtccagggcgcgatctggaac
atcgactccttcgaccagtggggcgtcgaactcggcaaggtcctcgccaaacgcgtcgag
cccgccctcaccgaaggcgcggacgtacccggcctcgacccctccaccgccgccctcgtg
gccgcgtaccgcactcaccggaagaagtga

KEGG   Streptomyces avermitilis: SAVERM_6302
Entry
SAVERM_6302       CDS       T00126                                 

Gene name
pgi2
Definition
(GenBank) putative glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sma_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6302 (pgi2)
   00030 Pentose phosphate pathway
    SAVERM_6302 (pgi2)
   00500 Starch and sucrose metabolism
    SAVERM_6302 (pgi2)
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_6302 (pgi2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6302 (pgi2)
Enzymes [BR:sma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     SAVERM_6302 (pgi2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAVERM_6302 (pgi2)
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6302 (pgi2)
  Exosomal proteins of colorectal cancer cells
   SAVERM_6302 (pgi2)
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-ProteinID: BAC74013
NITE: SAV6302
UniProt: Q829V7
Position
7565234..7566886
AA seq 550 aa
MNADSRTRLNQRPEWTALAKHREELAGTHLRDLFAADPGRGAGYTLEVGDLHVDYSKHLV
TDETLRLLRELAAATDVFGLRDAMFRGEKINVTEDRAVLHTALRAPRDAVVEVDGENVVP
AVHAVLDKMSTFAERVRTGEWTGHTGKPIKNIVNVGIGGSDLGPAMAYEVLRSFTDRSLT
VRFVSNVDGADLHEAVRDLDPAETLFVIASKTFTTIETITNATSARDWLLTELKAGQEAV
AKHFVALSTNAEKVSEFGIDTANMFEFWDWVGGRYSFDSAIGLSLMIAIGPERFREMLDG
FRIVDEHFESAPAEDNVPLLLGLLGIWYGNFHDAQSHAVLPYSHYLSKFTAYLQQLDMES
NGKSVQRDGNPVEWETGPVVWGTPGTNGQHAYYQLIHQGTKLIPADFIGFAEPVADLLPG
LVAQHDLLMANFFAQTQALAFGKTPDEVRAEGVPEQLVPHKTFKGNHPTTTILAKELTPS
VLGQLIALYEHKVFVQGAVWNIDSFDQWGVELGKVLAKRVEPALTEGADVPGLDESTKAL
VAKYRQLRGR
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgaacgcagacagccgtaccaggctcaaccagaggcctgagtggaccgctctggccaag
caccgcgaagaactcgcgggcacccatctgcgggacctgttcgcggccgaccccgggcgc
ggtgccggatacaccctcgaggtcggcgatctgcacgtcgactactccaagcacctcgtc
accgacgagacgctgcggctgctgcgcgagctggccgccgcgaccgatgtgttcgggctg
cgggacgccatgttccgcggcgagaagatcaacgtcaccgaggaccgcgccgtcctgcac
acggcgctgcgcgccccgcgggacgcggtcgtcgaggtcgacggcgagaacgtggtgccg
gccgtgcacgccgtgctcgacaagatgagcaccttcgcggagcgcgtccgtacgggggag
tggaccgggcacaccggaaagcccatcaagaacatcgtcaacgtcggcatcggcggctcg
gacctcggcccggccatggcgtacgaggtgctgcgctccttcaccgaccgttcgctgacc
gtccggttcgtgtcgaacgtggacggtgccgacctgcacgaggccgtccgcgacctggac
ccggccgagacgctgttcgtgatcgcctcgaagacgttcaccacgatcgagacgatcacc
aatgccacctcggcccgcgactggctgctgaccgagctgaaggccggtcaggaagccgtc
gccaagcacttcgtggcgctgtcgacgaatgccgagaaggtgtcggagttcggcatcgac
acggcgaacatgttcgagttctgggactgggtcggcggccgctactcgttcgactcggcg
atcggcctgtcgctgatgatcgcgatcgggccggagcggttccgcgagatgctcgacggg
ttcaggatcgtcgacgagcacttcgagagcgcccccgccgaggacaatgtgccgctgctg
ctgggcctgttgggcatctggtacggcaacttccacgatgcccagtcgcacgcggtgctg
ccctacagccactacctgtccaagttcaccgcctacttgcagcagctcgacatggagtcg
aacggcaagtcggtacagcgggacggcaacccggtggagtgggagaccgggcccgtcgtg
tggggcactccgggcaccaacgggcagcacgcctactaccagctcatccaccagggcacg
aagctgatcccggccgacttcatcggcttcgccgagccggtcgccgatctgctgcccggc
ctggtcgcccagcacgacctgctgatggccaacttcttcgcccagacgcaggcgctggcc
ttcggcaagacgccggacgaggtgcgggccgagggcgtgcccgagcagctggtgccgcac
aagacgttcaagggcaaccacccgacgaccacgatcctcgcgaaggaactgactccgtcg
gtgctcggccagctgatcgcgctctacgagcacaaggtgttcgtccagggcgcggtctgg
aacatcgactccttcgaccagtggggcgtcgaactcggcaaggtcctcgccaagcgcgtc
gaaccggcactgaccgagggcgcggacgtgccgggtctggacgagtcgacgaaggcgctg
gtcgccaagtaccggcagctgcggggccggtag

DBGET integrated database retrieval system