KEGG   Streptomyces avermitilis: SAVERM_1790
Entry
SAVERM_1790       CDS       T00126                                 

Gene name
arcB1
Definition
(GenBank) putative ornithine cyclodeaminase
  KO
K01750  ornithine cyclodeaminase [EC:4.3.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_1790 (arcB1)
Enzymes [BR:sma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.12  ornithine cyclodeaminase
     SAVERM_1790 (arcB1)
SSDB
Motif
Pfam: OCD_Mu_crystall F420_oxidored GFO_IDH_MocA
Other DBs
NCBI-ProteinID: BAC69501
NITE: SAV1790
UniProt: Q82M70
Position
complement(2186588..2187568)
AA seq 326 aa
MTDDDVLYLSSRRVTELLDTDAAIASQRAAFTALGDGTAELPGKIMYPSRFDDSVVFAYV
SRLSADTGTVAKFGSVNPGNPAAGLASVHAVINALDPVTGRLVAVMDGTAVTTLRTAAAS
AVAFDALATADASELGLLGSGTQALAHARAVARVRDLRSVRVWSPNPGRREQAAQRLAAE
LGVAAKGVDTAEEAVAQVPMVAACTLSRTPVVRGEWLAPGCTVVSVGSFEPTRSEVDAEV
LRRAAAVVVDDPGTAADHAGPVVDALRERRLAPDDLIPLGAVVTGRHTARTSPGDIVFYN
SVGLGIQDAAAAWAVIAAARGPREHP
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaccgacgacgacgtcctctacctctcctcgcgccgcgtgacggaactgctggacacc
gacgcggcgatcgcctcgcagcgcgccgcgttcaccgcgctcggcgacggcaccgccgag
ctccccggcaagatcatgtaccccagccggttcgacgacagtgtcgtcttcgcgtacgtc
tcgcggctgtccgcggacaccgggaccgtcgccaagttcggcagcgtcaatcccgggaac
ccggccgcaggtctggccagcgtccacgcggtgatcaacgcgctcgacccggtgaccggc
cggctcgtggccgtcatggacggtacggcggtcaccacactgcggaccgccgccgcgagc
gccgtcgccttcgacgcgctggccaccgccgacgcctccgagctgggccttctcggctcc
ggcacccaggcactcgcccatgcgcgggccgtcgcccgggtgcgggacctcaggtccgta
cgcgtctggagcccgaaccccggccgccgcgagcaggcggcccagcggctcgccgccgaa
ctcggtgtcgccgccaagggtgtcgacaccgccgaggaagccgtggcccaagtgcccatg
gtcgccgcctgcacactgagcaggacgccggtcgtacgcggcgagtggctcgcgccgggg
tgcacggtggtgagcgtgggttccttcgagccgacccgcagcgaggtcgacgccgaggtg
ctgcggcgggccgcggcggtggtcgtcgacgatccggggaccgcggccgaccacgcggga
ccggtggtggacgcgctgcgggagcggcggctcgccccggacgacctgatcccgctcggc
gccgtggtcaccggccggcacaccgcgcggacgagccccggcgacatcgtcttctacaac
agcgtcggactcggcatccaggacgcggcggcggcctgggccgtgatcgccgcggcccgc
ggaccacgggagcacccatga

KEGG   Streptomyces avermitilis: SAVERM_3645
Entry
SAVERM_3645       CDS       T00126                                 

Gene name
arcB2
Definition
(GenBank) putative ornithine cyclodeaminase
  KO
K01750  ornithine cyclodeaminase [EC:4.3.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_3645 (arcB2)
Enzymes [BR:sma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.12  ornithine cyclodeaminase
     SAVERM_3645 (arcB2)
SSDB
Motif
Pfam: OCD_Mu_crystall GFO_IDH_MocA Shikimate_DH
Other DBs
NCBI-ProteinID: BAC71357
NITE: SAV3645
UniProt: Q79Z74
Position
complement(4516629..4517633)
AA seq 334 aa
MLILRRADVTDVLSGRETEIIDLVAETYRLHDEGQTSLPHSTFLRFPEEHHSRDRIIGLP
AYRGGERPVAGMKWISSFPGNVAAGTDRASAAVVLNSLGNGHPVAFVEGAVISAKRTAAS
AALAARELTADNPPAAALLIGCGVINLEILRFLAAALPDLREAALYDTDPARAEAFAARC
AEEVPGVKARPVTDLAAALGEHRLVSLATTAATPHMDLSACGPDTTVLHISLRDLTAEAV
LGAVNVVDDADHVCRERTSLDLAQQATGNRDFVAAPIGALLRGTATLRRTADRPVVYSPF
GLGVLDLALAEFVREEADRRGLGVRVEDFLPAFA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgctgattctccggcgcgccgatgtgacggacgtcctgtccggccgggagacggagatc
atcgacctcgtcgccgagacctaccggctgcacgacgaggggcagacgtccctgccgcac
tcgacgttcctgcgtttccccgaggagcaccacagccgggaccggatcatcggcctgccg
gcctaccggggcggtgagcggcccgtcgccggaatgaagtggatctcctccttccccggc
aacgtggccgccggcaccgaccgggccagcgccgccgtcgtcctcaactccctcggcaac
gggcacccggtggcgttcgtcgagggtgcggtgatctccgcgaagcgcaccgccgcgagc
gcggcgctcgccgcccgggaactcaccgcggacaacccgcccgccgccgcgctgctgatc
ggctgcggtgtgatcaacctggagatcctgcgcttcctggccgccgccctgccggacctg
cgcgaggccgccctgtacgacacggacccggcccgcgccgaggccttcgccgcacggtgc
gccgaggaggtccccggggtgaaggcccgtccggtgaccgacctggccgccgcgctcggc
gagcaccgcctcgtctccctcgccaccaccgccgcgaccccgcacatggacctgtcggcg
tgcggcccggacaccaccgtgctgcacatctccctgcgggacctgaccgccgaggccgtc
ctcggggcggtcaacgtcgtcgacgacgccgaccacgtgtgccgcgagcgcacctccctc
gacctcgcccagcaggccaccggcaaccgtgacttcgtcgccgccccgatcggcgccctg
ctgcgcggcacggccacgctccgccgcaccgcggaccggcccgtcgtctactccccgttc
ggtctgggcgtgctcgacctggcgctcgccgagttcgtgcgcgaggaggccgaccggcgc
ggcctcggcgtacgcgtcgaggacttcctgcccgcctttgcctga

KEGG   Streptomyces avermitilis: SAVERM_5617
Entry
SAVERM_5617       CDS       T00126                                 

Gene name
arcB3
Definition
(GenBank) putative ornithine cyclodeaminase
  KO
K01750  ornithine cyclodeaminase [EC:4.3.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_5617 (arcB3)
Enzymes [BR:sma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.12  ornithine cyclodeaminase
     SAVERM_5617 (arcB3)
SSDB
Motif
Pfam: OCD_Mu_crystall Glu_dehyd_C Shikimate_DH
Other DBs
NCBI-ProteinID: BAC73329
NITE: SAV5617
UniProt: Q82BT7
Position
complement(6794587..6795618)
AA seq 343 aa
MTMPDASTTAAAEPIPRADRHLRILSTGDLAGIDISLADVVSTVEDAYRTLHAGESDNPR
KLTVKPRDGHSVAYAMLGRDGSRDVVAVKTSYKHGLDKGREEQHYYTTLTLYDDVTGLPV
AMMDCSRIGSLRTPAVSALLARECAAPGARSALVIGTGTQGRLALPFLLTTLPGLDRLML
FGTHPEGVTAVRERLRAHFPDRDVEIVTDAGAAASEADIIVATAGGHTPAAVGADRLKPG
SLSILVGHGLAPSALHRADRVIATSEAQMKVTGIDMADADGELRAVDAEFPPVITGDTAG
RRTATERIFAYNSGLVVTDIALGHRFAQLALEQGLGTEVALWR
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaccatgcctgacgcctcgaccaccgccgccgccgaaccgataccccgcgccgaccgg
cacctgcggatcctctcgaccggcgatctggccgggatcgacatctccctggccgacgtg
gtgtccaccgtggaggacgcctaccgcaccctgcacgccggtgagtccgacaacccccgc
aagctcaccgtcaagccgcgggacgggcattcggtcgcgtacgcgatgctcggccgggac
ggctcccgcgacgtcgtcgccgtcaagacctcctacaagcacggcctggacaaggggcgc
gaggagcagcactactacaccacgctgaccctctacgacgatgtcaccgggctgcccgtg
gcgatgatggactgctcccggatcggatcgctgcgcaccccggcggtctccgcgctgctg
gcccgcgaatgcgccgcccccggtgcgcgcagcgccctggtcatcggtacgggcacccag
ggccgtctggcgctgcccttcctgctgacgacgctgcccgggctggaccggctgatgctc
ttcggcacccaccccgagggcgtcaccgcggtgcgcgagcggcttcgggcgcacttcccg
gaccgggacgtggagatcgtcaccgacgcgggggccgcggcctcggaggccgacatcatc
gtggccacggccggcggccacaccccggccgcggtcggggcggaccggctcaagccgggc
tccctgtccatcctcgtgggccacggtctcgccccgtcggccctgcaccgggccgaccgg
gtgatcgccaccagcgaggcccagatgaaggtcaccggcatcgacatggccgacgccgac
ggcgaactccgcgcggtcgacgccgagttcccgcccgtgatcaccggcgacaccgcgggc
cgccgcaccgcgacggagcggatcttcgcctacaacagcggactcgtcgtcaccgatatc
gcgctggggcaccgcttcgcacagctcgccctcgaacagggcctgggcaccgaggtggca
ctgtggcggtga

DBGET integrated database retrieval system